Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042851 (Zc3h6)
Chromosomal location
Chr 2: 128793143 - 128843320 (+)
Description
zinc finger CCCH type containing 6 Gene [Source:MGI (curated);Acc:Zc3h6-001]
RefSeq_peptide
NP_848491.2 
UniGene
Mm.26377 
MGI
MGI:1926001 
Uniprot/SWISSPROT
Q8BYK8 
Uniprot/SPTREMBL
A2AP88 Q571G5 A2AP87 
Human Ortholog
ENSG00000188177 (ZC3H6)
Omim not available
UniTrap UNI13759
Vector Insertion
Chr 2: 128793573 - 128816826
Public Clones (ggtc) CMHD-GT_270F8-3 (cmhd) IST10045A7 (tigm)
Private Clones OST341322 (lexicon) OST318781 (lexicon) OST318769 (lexicon) OST288198 (lexicon)
OST258058 (lexicon) OST250352 (lexicon) OST138651 (lexicon) OST129967 (lexicon)
OST84489 (lexicon) OST44723 (lexicon) OST44698 (lexicon) OST38316 (lexicon)
OST34520 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20657
Vector Insertion
Chr 2: 128817008 - 128818894
Public Clones not available
Private Clones OST355521 (lexicon) OST90139 (lexicon) OST50512 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24480
Vector Insertion
Chr 2: 128819018 - 128819114
Public Clones not available
Private Clones OST218411 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110320
Sequence
GCCTGTTTCGGGTGCCGCCATGTTGGTGAGGAGAAATCACCGTTACGGCCACTGTCCAAATCCCCGCGTCGCTGCACGCCGCCCGCCGGCTCCCACGCCT

CAGCCTCCGGCGGCGAATACAGACTAGAGCGGCAGCGCCGGCAGCGCGGGGCCGTTGCCCAGTCTTTGCAGTTAGAGCCCCATCTCTCTGGCGTTGGTTG

TTAATAGACTGGAAAGTCTGTGTCTGTGTCGCTCACTAGTAACCGTGAGTTTTTACCACTTCGTCACCTGTCGGCGGCGGCCGGGGACAGGGTTGCCCGC

AGGCGGCGCAGGGGTCCTCCCCGCGCCCCGCTGCCGCCGCCACCGCCGCCGCCGGCCTCCAGACCTGCCCTCCAGCCCCGCCCCGTTCTTGACCAAACAT

GACAGACTCTGAACATGCAGGGCACGACAG - UNI13759 - AGAAGATGGTGAATTAGAAGATGGAGAAATAGATGATGCAGGATTTGAAGAAACAC

AAGATCAGGAAGCAAAAGAAAATGAAAAGCAAAAAAATGAGAAAGCCTACAGAAAATCAAGGAAAAAACACAAGAAAGAAAGAGAAAAGAAAAAATCCAA

AAGGAGGAAACACGAGAAACATAAG - UNI20657 - CATAACTCTCCATCTGGTGATGATAGTTCTGACTACAGCCTGGACTCAGATGTTGAACGTA

TGCAAAGTTCCCGTAAGAAAAGAACCAGCTCCTACAGGGATTATGATGTTCCATTTTCTCAG - UNI24480 - CATAGACGTATATCAGGAAGTTAC

ATGACATCAAAGAAGAGTCAACATAACAAAAAAACTAATAGTAAAGAATATGCTGAGTCCAGTTTCTACAGTGATGACTACTTTGGTAACTACAGTGATG

ACAACTTTGGTAACTATAGTAACCAGGAAGGAGAAGAAGATTTCTCCAGTCAGCTGAAATACTATCGACAGTCCCAGGAGTCCTCAGGGTCATCGTTCTC

TAAGGAATCAGGGAAGAAACTGAGAAGTAAAGGAAGCCCACCAG GAACTGAATATCGGATTAAAAGTTTTGATGTTAGTCATGGACATCTTTTGCCGAA

GAAAATCAGAAGAAAAGAACACTGTGGGGCACGAGTCATTAAAGGGCCTTATGTCTTTTCAGGAATGGATGACTTTCAAGAG TACAGCAAACCAGGGAA

AAAGTGGAAAGTTATGACTCAGGAGTTTATTAACCAGCACACAGTGGAACACAAAGGAAAACAGATCTGTAAATACTTCCTGGAAGGGAGATGTATTAAG

 GGAGATCATTGTAAATTTAATCATGATGCAGAATTGGAGAAGAAAAAGGAGGTCTGCAAATATTATTTACAGGGATATTGTACCAAAGGAGAGAACTGC

ATTTACATGCATA GTGAATTTCCTTGCAAGTTCTATCATAGTGGAGCAAAGTGCTACCAAGGAGACAAGTGTAAGTTTTCCCATGATGATCTGACTAAA

GAAACAAGGAAACTTTTGGACAAA GTGTTGAATGCGGATGAAGAACTTGTAAATGAAGACGAAAGAGAATTAGAAGAACTTAGGAAACGCGGCATAACT

CCTCTCCCCAAACCACCCCCGGGAGTCGGCCTTCTCCCGACCCCATCAGAGCATTTTCCGTTTTCTGATCCTGAAGATGATTTTGAGACGGATCTTTCTG

ATGATATGAAGAAAATTCCATCTCTTTTTGAAATAGTTGTAAAACCTACTGTGGATTTAGCACATAAAATTGGGAAGAA ACCACCAGCATTTTACAACA

GTACCTCACCACCAGGACCACAGTTTGAGGAAAGCAGTCACTGTCCACAGCGTATGTACAGTTCTGAGTCAAGTCCAGGTCCAGGATCTAAAGTTCCTCA

AGGATGTGAGAGTCCTGTGAGGCACCCAGGCTCCCCTGGACACCACCCTTGTGTAGGACCTCCTGGTCCACCAATGCAAGAGAACCCATCTTTGCTACCC

AGTTCATCTGAAATTGTAGGCCCTCATAGTCAAGCTGGAGGGCTTGTTCAGCTGGACACGCTACCAAGCATGGGTGGAGCTTACCATTCCCCGGGCTTTC

CAGGACACTCGGTGAAAGTCCCTAGAGAGAGTCACAGCTCTCCAGCTTCACTGTACCAGCAAATGCCTAGTGAGATGCAACGCAGTGCCGACTCTGAGTC

CATGCAAGGCTCAGCTGAATTTTATGATGATTACTACCCACAGCATGCTGCACATAATTTTCAACCACCTGATAACTCTGCTG ATGAGATGTGGCATGA

AGAGTTTGCACAGCAGCAGCCTCCCATTGCTCGTGACACAGCACACCTTGGGAGTGGGCCCAATTCCAGCAGCAGAATGACAAGTCACTGCCCTCTGTCT

GCTTCAGGGCTCCCTCCTGCAGTGCAGAGAGCTCTTTTCATCCCGTTGACTCAGAGATACCAAGAAGATGAAGAACCAGCTGGCACCCAGCCTCATAGAG

CATCAAGCAAGGAAGAAG ATGATACAGCTAACTGGTATTCCAGTAGTGAAGAGGAAGAAGGAAGTGGTGTCAAGTCAATACTGAGGACATTACAGAAAC

AAACAGGAACACTGAGAAACCAGCAACTCCCTCCCACAGAGCTCAGCGTTCCTACTGATCCAAGACTCGCTAAAGAGAAAAGGAAAAGAAATCAAGTGGT

TGACCCAAGACTTCGGACTGTCCCAAGGCAAGATATTAAAAAGCCGCATGAGTCTGTCCCAGTGGACCTTAGACTTGTGTGGGACCCCAAGAAATTAAGA

GGGAATGGAGGTGCTCCTGGGGGCTCTTCAGCTAGGGGAGCAGAGTTTGACTTACGTCATACAAATGCTGGTGCAAATCACAAATCCAAAAGAAGAGAGG

ATGATGATGAAGATTCAGAAAGAGAACTAAGAGAAAAGGCCTTCTTAATACCTTTGGATTCTTCACCTGGCATAGTCCTCCAGGATCCAAGGTCACAGTT

AAGACAATTCAGTCATATTAAAATGGACATTATTCTAAACAAACCCAACTTTGCAAAACACATTGTGTGGGCTCCAGAAGACTTACTTCCAGTACCTTTA

CCTAAACCTGATCCAGTATCTTCAATCAACTTACCTCTGCCCCCACTTATAGCTGACCAGAGGCTCAATAGATTATGGAATACAAAGAGTGATCATCAGG

GTGCCCTGAGCCTTGATCCAACATCAGCAGCCAAAGCCAAACTGAGTCTAACACACAGAGAGGGCTGCTTAGAGCAGTCTGGAGACTTACACAGTTCAGG

AGGTAAACTAGGAGACCCTAGGCTGCAAAAGAATTTTGATCCTAGGCTTCATAGACTGCCCAATACAGAGTCTCATCAAGTGACTGCAAAGGATTCACAC

TCATCAAGGAGTGCCCTGCCCTTAGCCAGATGGAACCCTGCTTTGTCACAGTCCTCAACAGCAGCACCTATTAATGTTGCTTCTGTGACTCCTCCCCTGT

ATGCCCCCAAACTCTCTTCAGAAGGCCTCCCACCGGGAACTTCAAGTTCAGTTCTTAGTGGCATTAGTTTGTATGATCCTAGGGATAAAGGTTCGTTATC

TGCAATGGAGCTATCAACCATTTCTTCAGGAGAAAATACAGAGAGCCAGAAAAAAAGTGGCTTAAAAAATAGTGATAAAAACCAGCCTTCTCCTGGAGAA

GTGATCGTACCACAGAACACTACTGCAAACTTGGAAGTCCCTGTTGATGGGCCAGTAGACATGCAGACAGATATTCTCAGGAGTGCTGATAAGGTTCAGG

TCCCTGCTGTGCACAGTCTTCCTATTCAGGCCTTAACAGGCTTACTTAGACCTCCATACAGTGATCCAAGGCAGGCAAGAGAACCAGGACAGGCAAGCCC

AACCCCAGATGAAGAAACAGATGACAAACCTCTGAAAGAGGTTTTTAAGACGTTTGATCCAACTGCATCACCGTTTTGTTAG
Translation
MTDSEHAGHDR - UNI13759 - REDGELEDGEIDDAGFEETQDQEAKENEKQKNEKAYRKSRKKHKKEREKKKSKRRKHEKHK - UNI20657 - 

HNSPSGDDSSDYSLDSDVERMQSSRKKRTSSYRDYDVPFSQ - UNI24480 - HRRISGSYMTSKKSQHNKKTNSKEYAESSFYSDDYFGNYSDDNFG

NYSNQEGEEDFSSQLKYYRQSQESSGSSFSKESGKKLRSKGSPPG GTEYRIKSFDVSHGHLLPKKIRRKEHCGARVIKGPYVFSGMDDFQE YSKPGKK

WKVMTQEFINQHTVEHKGKQICKYFLEGRCIK GDHCKFNHDAELEKKKEVCKYYLQGYCTKGENCIYMHS SEFPCKFYHSGAKCYQGDKCKFSHDDLT

KETRKLLDK VLNADEELVNEDERELEELRKRGITPLPKPPPGVGLLPTPSEHFPFSDPEDDFETDLSDDMKKIPSLFEIVVKPTVDLAHKIGKK KPPA

FYNSTSPPGPQFEESSHCPQRMYSSESSPGPGSKVPQGCESPVRHPGSPGHHPCVGPPGPPMQENPSLLPSSSEIVGPHSQAGGLVQLDTLPSMGGAYHS

PGFPGHSVKVPRESHSSPASLYQQMPSEMQRSADSESMQGSAEFYDDYYPQHAAHNFQPPDNSAD DEMWHEEFAQQQPPIARDTAHLGSGPNSSSRMTS

HCPLSASGLPPAVQRALFIPLTQRYQEDEEPAGTQPHRASSKEED DDTANWYSSSEEEEGSGVKSILRTLQKQTGTLRNQQLPPTELSVPTDPRLAKEK

RKRNQVVDPRLRTVPRQDIKKPHESVPVDLRLVWDPKKLRGNGGAPGGSSARGAEFDLRHTNAGANHKSKRREDDDEDSERELREKAFLIPLDSSPGIVL

QDPRSQLRQFSHIKMDIILNKPNFAKHIVWAPEDLLPVPLPKPDPVSSINLPLPPLIADQRLNRLWNTKSDHQGALSLDPTSAAKAKLSLTHREGCLEQS

GDLHSSGGKLGDPRLQKNFDPRLHRLPNTESHQVTAKDSHSSRSALPLARWNPALSQSSTAAPINVASVTPPLYAPKLSSEGLPPGTSSSVLSGISLYDP

RDKGSLSAMELSTISSGENTESQKKSGLKNSDKNQPSPGEVIVPQNTTANLEVPVDGPVDMQTDILRSADKVQVPAVHSLPIQALTGLLRPPYSDPRQAR

EPGQASPTPDEETDDKPLKEVFKTFDPTASPFC
Transcript ENSMUST00000110319
Sequence
GCCTGTTTCGGGTGCCGCCATGTTGGTGAGGAGAAATCACCGTTACGGCCACTGTCCAAATCCCCGCGTCGCTGCACGCCGCCCGCCGGCTCCCACGCCT

CAGCCTCCGGCGGCGAATACAGACTAGAGCGGCAGCGCCGGCAGCGCGGGGCCGTTGCCCAGTCTTTGCAGTTAGAGCCCCATCTCTCTGGCGTTGGTTG

TTAATAGACTGGAAAGTCTGTGTCTGTGTCGCTCACTAGTAACCGTGAGTTTTTACCACTTCGTCACCTGTCGGCGGCGGCCGGGGACAGGGTTGCCCGC

AGGCGGCGCAGGGGTCCTCCCCGCGCCCCGCTGCCGCCGCCACCGCCGCCGCCGGCCTCCAGACCTGCCCTCCAGCCCCGCCCCGTTCTTGACCAAACAT

GACAGACTCTGAACATGCAGGGCACGACAG - UNI13759 - AGAAGATGGTGAATTAGAAGATGGAGAAATAGATGATGCAGGATTTGAAGAAACAC

AAGATCAGGAAGCAAAAGAAAATGAAAAGCAAAAAAATGAGAAAGCCTACAGAAAATCAAGGAAAAAACACAAGAAAGAAAGAGAAAAGAAAAAATCCAA

AAGGAGGAAACACGAGAAACATAAG - UNI20657 - CATAACTCTCCATCTGGTGATGATAGTTCTGACTACAGCCTGGACTCAGATGTTGAACGTA

TGCAAAGTTCCCGTAAGAAAAGAACCAGCTCCTACAGGGATTATGATGTTCCATTTTCTCAG - UNI24480 - AATTCAGCCATCACTGTGGTTCAT

CTCCAGAATCTTATCCACCTGACACAGAAATTCTGTACCTCAGAGGCAGACCTGCTCCGCAGCCCTCTGACTGCTGTCCTCACTTTCTGTCTATGA
Translation
MTDSEHAGHDR - UNI13759 - REDGELEDGEIDDAGFEETQDQEAKENEKQKNEKAYRKSRKKHKKEREKKKSKRRKHEKHK - UNI20657 - 

HNSPSGDDSSDYSLDSDVERMQSSRKKRTSSYRDYDVPFSQ - UNI24480 - NSAITVVHLQNLIHLTQKFCTSEADLLRSPLTAVLTFCL

For any suggestions or comments, please send an email to unitrap@crg.es