Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000042854 (Trp53rk)
Chromosomal location
Chr 2: 166618031 - 166621652 (+)
Description
transformation related protein 53 regulating kinase Gene [Source:MGI (curated);Acc:Trp53rk-001]
RefSeq_dna
NM_023815 
RefSeq_peptide
NP_076304.2 
UniGene
Mm.330796 
MGI
MGI:1914050 
Uniprot/SWISSPROT
Q99PW4 
Uniprot/SPTREMBL
A2A5R0 Q8C5U8 Q543M9 
Human Ortholog
ENSG00000172315 (TP53RK)
Omim not available
UniTrap UNI26465
Vector Insertion
Chr 2: 166619889 - 166620881
Public Clones not available
Private Clones OST116528 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000065753
Sequence
GGGTTCTGGGTGTGTTTTGCTGGAGAACACATCCTGCCACACAAAGGGTCTGATGATGAAAAGGAACCTGTCATGAATATGAACGAAACCCAGGGACCAC

AGAGCCAAGATGCTGGTGCCATAGCAACCCGGGATCCAAGGGCTTCTCTTCTGTTCCAGGAATAAGAAGGGCAGAGT AAGTCATGCGAAGAGGGCCTCT

GTCCACCGGCATCTTGTAATCAGGCTCTTGTTAAATTCTGATAAGCCCCAACCCCAGAAGAACCAGGCAGCCTCATTCTGAAGAATAGGAAACCGGAACT

CAAAGGGATGGTGTGGGCTGCTGACATCGGTTGGCATCACCAGGTAGAAAGCTTTGCCTAGTCTGTCTGTCCTTCCCTCTTGGATTACATAGTACGTTTC

CATCGGTTAATGTGTGAGGATCACAAGTTCAAAGCTAACCTGAGATACACAGTGAGATCCGGTCTTTAAAAAGTAAAGGATTTTTCTATGCTAGTAGAAA

GGAGCAGAGTATCCCCAACAGCATCGCCAACGAGTTTCCTGAGAGAGCTAGAGAGAGAGAGAGAGAGAAGCTGTTGACTAAAAGTTGCCGAGCGCACACG

GATACAGACAGGAACCAAGTCTACAGGGAAGGGCCAAGTCTACAGGTCCGAGAGGCTCCGCTGAGCGCGGAAAGGTCGCGAGGCGGAACCACACTAGCAG

GGTGAAGTGTGTTGTGGGAGCGGTGTTCATGGCGGAAGAGGCCGGAGGATTTCCGAAGCGAGCGGAAGCGGCGCGGTCAGGGTCGGAAGGAGTCGGAGGC

ATGGCTGGTGTGTCCTCGGAGGCGGAGGCCGAGGCGCTGGCCGCGGCGCGCGAGCGGAGCCGCCTCTTCCTGAGCGGCCTAGAGCTGGTGCAGCAGGGCG

CCGAGGCGCGCGTTTTCCGTGGCCGCTTCCAGGGCCGCGCGGCCGTGGTGAAGCACCGCTTCCCGAAGAGTTACCGGCACCCGGAGCTGGAGGCGCGGCT

CGGCCGTCGGCGGACGGTGCAGGAGGCGCGCGCGCTGCTCCGCTGCCGCCGTGCGGGTGAGGGGGGCCGGACGGGGCTCCGGGAGACGGGACAGACAGGG

CTGCGGGAGACCGGTGGGACGGGAGAGACCGGGCTCCGAGTTCCGGGGGTCCGGACCAAATAACAACGCCCTGGGTAGTTTTAAGCATCTGTCCTGCCAG

GCGCGCGTCTGGAGCTAGCTTTCTGAATTCAGATTATACCCTTCTGTGAGTTGCCTTGCCTAAATTTCCCGAGTTCTAATCGGAAGTCATAGTCGAGTTC

GCATCTCGGGGATGTTGTGAGTGGCCTATACAAACGTGTATGTTGGCATGACATCCAATAAATGTCAGACTTCATG
Translation
 MAEEAGGFPKRAEAARSGSEGVGGMAGVSSEAEAEALAAARERSRLFLSGLELVQQGAEARVFRGRFQGRAAVVKHRFPKSYRHPELEARLGRRRTVQE

ARALLRCRRAGEGGRTGLRETGQTGLRETGGTGETGLRVPGVRTK
Transcript ENSMUST00000051923
Sequence
GGAAGGAGTCGGAGGCATGGCTGGTGTGTCCTCGGAGGCGGAGGCCGAGGCGCTGGCCGCGGCGCGCGAGCGGAGCCGCCTCTTCCTGAGCGGCCTAGAG

CTGGTGCAGCAGGGCGCCGAGGCGCGCGTTTTCCGTGGCCGCTTCCAGGGCCGCGCGGCCGTGGTGAAGCACCGCTTCCCGAAGAGTTACCGGCACCCGG

AGCTGGAGGCGCGGCTCGGCCGTCGGCGGACGGTGCAGGAGGCGCGCGCGCTGCTCCGCTGCCGCCGTGCGG - UNI26465 - GGATAGCTGCCCCA

GTCGTCTTCTTTGTGGACTATGCGTCTAACTGCTTATATATGGAAGAAATCGAAGACTCGGTGACTGTTCGGGATTATATCCAATCCACTATGGAGACTG

AAAAGGACCCCCAGTGCCTCTTGGACCTGGCCAGGAGGATGGGGCAGGTTCTGGCCGGAATGCACGACCAAGACCTCATTCACGGGGACCTCACCACCTC

CAACATGCTCCTGAGGCGGCCCCTGGCGCAGCTGCACATCGTGCTCATCGACTTTGGGCTGAGCTTTGTCTCAGGACTGCCGGAAGATAAAGGCGTCGAC

CTCTATGTCCTGGAGAAGGCCTTCCTCAGCACGCACCCCCACACCGAGACCGCGTTTGAAGCCTTTCTGAAGAGTTACGGGGCCTCGTCCAAGAAGTCCA

GTCCAGTGCTGAAGAAGTTAGATGAGGTGCGCCTGAGAGGGCGAAAGCGGTCCATGGTCGGGTAGTGGAGCTGTGGTGAACTGGCTCACGGTGAAGGATG

ATGTAGACGAGGCTGGACCCCTCAGCAAAGCATGGGTTGTTAAGTGGTCTGTGATCGTGCTGGGCCACCACCATCCATGGCTCACTGTTCTCAGGGGCTT

CATGTACATGAGGTTTATTCTGGGCAGAACTGGGTAGGTAGCCCAGGCTAGCCTTGAATTTATGGCAACATCCTACCTCAGCTTGCTTGGAAGAGGTTAT

AAGCCACCATACCTGACTTTGCACTGATTCTGTCAGAAACAAAACAACTATGACTCT
Translation
MAGVSSEAEAEALAAARERSRLFLSGLELVQQGAEARVFRGRFQGRAAVVKHRFPKSYRHPELEARLGRRRTVQEARALLRCRRAG - UNI26465 - 

GIAAPVVFFVDYASNCLYMEEIEDSVTVRDYIQSTMETEKDPQCLLDLARRMGQVLAGMHDQDLIHGDLTTSNMLLRRPLAQLHIVLIDFGLSFVSGLPE

DKGVDLYVLEKAFLSTHPHTETAFEAFLKSYGASSKKSSPVLKKLDEVRLRGRKRSMVG

For any suggestions or comments, please send an email to unitrap@crg.es