Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000043257 (Pigv)
Chromosomal location
Chr 4: 133217343 - 133228513 (-)
Description
phosphatidylinositol glycan anchor biosynthesis, class V Gene [Source:MGI (curated);Acc:Pigv-002]
RefSeq_dna
NM_178698 
RefSeq_peptide
NP_848813.2 
UniGene
Mm.217004 
MGI
MGI:2442480 
Uniprot/SWISSPROT
Q7TPN3 
Uniprot/SPTREMBL
A2BH42 A8WHZ1 
Human Ortholog
ENSG00000060642 (PIGV)
Omim not available
UniTrap UNI8531
Vector Insertion
Chr 4: 133225776 - 133228233
Public Clones RRO094 (baygenomics) M016F08 (ggtc) FHCRC-GT-S21-12G1 (fhcrc) PST9521-NR (escells)
IST14309C5 (tigm) IST13537D8 (tigm) IST14569H12 (tigm) IST10013D11 (tigm)
Private Clones OST418481 (lexicon) OST42067 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30197
Vector Insertion
Chr 4: 133220572 - 133225776
Public Clones D082B05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14099
Vector Insertion
Chr 4: 133218707 - 133220572
Public Clones CMHD-GT_116D9-3 (cmhd) CMHD-GT_395H5-3 (cmhd) CMHD-GT_330A10-3 (cmhd) IST14132D7 (tigm)
IST10484E4 (tigm) IST10024B12 (tigm) IST13898G2 (tigm) IST11826H6 (tigm)
IST11584H3 (tigm) IST13797B5 (tigm) IST12545D11 (tigm) IST11834C11 (tigm)
IST15093F6 (tigm) IST11089B2 (tigm) IST13692C2 (tigm) IST14354B3 (tigm)
IST11824A6 (tigm) IST13283B4 (tigm) IST14796A2 (tigm) IST13134H8 (tigm)
IST13175D10 (tigm) IST14219D7 (tigm) IST13194E1 (tigm) IST13411E1 (tigm)
IST14851B1 (tigm) IST10661A1 (tigm) IST11824B6 (tigm) IST12846G3 (tigm)
Private Clones OST399363 (lexicon) OST285915 (lexicon) OST281997 (lexicon) OST117529 (lexicon)
OST39749 (lexicon)
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000062118
Sequence
AGTTGGAGCTCCGCGGGGGTGGTCTGGACGCGCGGGCGCGGAGGATCCGGCGCCAGCTCTGCAACTCTGGAGTCCTCCGGGGAGGGAAGCTGTCAAACGC

AGGCCGAGAGAAATTAGGCGGAGGCTGTAGAGAAGCGAGGAGCCCCGCCCCTCCGCCATAGCAGCCTCCGGCGCCGCCTCTTCCTTTGCAGCCTCCGGCC

CTCGTCTGCTTCCGGCCCCGTTGCCTGGCCCGGCCCCGCGATTCCCCCGGGACGAAGCCCTGGGCCGTGGCTCCCTTGGG - UNI8531 - - UNI30

197 - AATTTAGAAGCCGGAGGAAGCTCAGTCCTGGTGGTGAGAGAGAGGATGGGACTCCTGGACCCATCCCAGAAAGAGGTGCTGAGATTCGCAGTAA

ACTGCCGCATCCTGACTCTAGTGCTACAG - UNI30197 - GCACTCTTCAACCTCATCATCCCAGATCACCACGCAGATGCCTTTTGCCCTCCCCGC

CTCGCCCCCTCGGGCTCTGCGGATCAGCTTGTGGAAGGTCTTCTGGGTGGTCTGTCTCGATGGGATGCTGAACACTTCCTGTTTATCGCTGAGCACGGCT

ACCTTTATGAGCACAACTTTGCCTTCTTCCCTGGCTTTCCCTTGGCCCTGCTGATGGGGACTGAGCTGCTGAGACCCTTGCAGGGCCTCTTGAGCCAGCG

CAGTTGCCTGCTGGTCTCAGTAGCACTTCTCAACTTGCTGTTCTCCGTGCTGGCTGCAGTGGCACTCCATGACTTGGGTTGTCTGGTTCTGCACTGTCCT

CGGCAGGCCTTGTGTGCAGCGTTGCTCTTCTGCATCAGTCCTGCCAACGTTTTCCTGGCAGCCGGCTACTCAGAGGCTTTGTTTGCCTTCCTGACGTTCA

GCGCCATGGGGCAGCTGGAGAGGGGCCGTGGCTGGGCTAGTGGGCTGCTCTTTGCTCTTGCTGCTGGGGTGCGCTCCAATGGGCTGGTGAGCCTTGGCTT

CCTCCTGCACTCCCAGTGCAGAGGCTTTTGTTCCTCTCTGGCGGTGCTGAGCCCCTGGAAGCCCCTCGTGAAGCTGATGGCCTCTGTGTGCTTGTCAGTG

CTCATAGTCAGCCTTCCCTTCGCCCTCTTTCAGTATCGTGCCTACATCCAGTTCTGCTCACCAGGCTCAGCCCCCTCCATCCCTGAGCCCTTGCTGCAGC

TAGCTGCCGACAAAGGCTACCGGCTTGCAGGAGAAAATGCACCCCCATGGTGCTCCTGGGACCTTCCTCTAATATACAACTATATTCAGGATGTCTACTG

GAATGTTGGTCTTCTGCGATACTATGAGCTCAAACAGGTGCCCAATTTCCTACTAGCTACACCAGTGACAGTACTGGTTGTGTGGGCAACCTGGACATAT

GTGACCACCCACCCTTGGCTCTGCCTTACACTTGGGCTGCAAAGAACCAAGGACAGGGAGAACCCGGAGAAGCCCCACCGTGGCTTCCTGAGTCCGAAGG

TGTTTGTGTACCTGGTCCACGCTGCAGCACTGCTGGTCTTTGGAGGTCTGTGCATGCATGTCCAG - UNI14099 - - UNI30197 - GTTCTCAC

GCGGTTTTTGGCCTCTTCCACTCCTATCATGTACTGGTTTCCAGCTCACCTGCTTCAGGATCAAGAACCGCTGCTGAGGTGTGTGGACACAGAGCCTGGG

AAGCTTCCTCAGGAGAAGTCCCCACCAGGACAGAAGGCCCCCAGAAACTGTCTCATGAAACTCTTCTACGATTGGAAGAGATGCTCTCCAGTCACAAGAT

GCGTTCTGGTCTACTTCCTGACCTACTGGCTTCTGGGACTAATTCTCCATTGCAACTTCCTGCCTTGGACTTGACCTGGAGTGTCAAGGAATGAAAGCTC

TAAGACGACACCCTGGCTGGGACAGCCCGCACACTCCGGAGAGCACTGTGCAGTAGGATCTCTGGGTCTCTCTGGGGGCCAGCTAAGAAGGGAAAATGGG

AGCACAGGCGCCCCTTCTCATCCTGGGCGGGGCAGGTGTAGGGGAGTAACTTCAGTGCTCAGTGCAGGGGTCTCAGATCTCCCTAGTCCACAAGTACTAG

GCAATCTTAAACCTACTACTGATCCACGTGTAAGTCTGTCTTCTTGTTTTTTGAGAGAAGGTTGGTTTCTCTACATTGCCCTGGTTGTCCTGGAACTCAC

TCTGTAGACCAAGTTTATGTAGACCAGGCTGGCCTTGAACTCAGAGATTCATCTGCCTCTGCCTCTTGAGTACTAGGCCCACCACTGAGTGTGAGCCACC

CCTGCCTGGCCTGGTGGATAAATTTAAATGTTTGATCAAAGCACAGGCCAACAGCCTGCCCCACTCAGGATGGTGGAGTCAGTGCAGTGTAGTGACAGAA

GGAAGAGGGGACAGACAGCCTGCTCTAAGTGAGAGGTTTCTGAAGGTGGTTGTTTTCTTTTTTTTTTTTTTTAAAGATGTATTATATTATATATGAGTAC

ACTAGCTGTCTTCAGACACACCAGAAGAGGGCATCAGATCCCATTGCAGATGGTTGTGAGCCACCATGTGGCTGCTGGGAATTGAACTCAGGACCTCTGG

AAGAGCAGCCAGTGCTCTTAACCACTGAGCCATCTCTCCAGCTCCCTGAAGTTTTCTTTATGATACTGGTGTGTGTGTGTCTGTGTCTATCCTACAGACT

GTGAAAATCTAAATACTCCTTTTGCAATGAATTACCTTTTTCTGGAGGAGGGGTAGTCAGGGGAGCTAAGACAAGGTCCCTCTGTGTAACTCTGACTGTC

CTAGAACTTGCTTGCTATGTAGATCTGGCTGGTTTTGAACTCAGAGATCCTCCTACCTCTGCCGAACTAGTTTCTATAAATTATAGAGGGTTGAGGCTAG

AACTCCGTAGTAAAGCACACGAGGCCCTAATTTCAGTAATAAACACCACTTGGATC
Translation
 - UNI8531 - - UNI30197 - MGLLDPSQKEVLRFAVNCRILTLVLQ - UNI30197 - ALFNLIIPDHHADAFCPPRLAPSGSADQLVEGLL

GGLSRWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLMGTELLRPLQGLLSQRSCLLVSVALLNLLFSVLAAVALHDLGCLVLHCPRQALCAALLFCISPA

NVFLAAGYSEALFAFLTFSAMGQLERGRGWASGLLFALAAGVRSNGLVSLGFLLHSQCRGFCSSLAVLSPWKPLVKLMASVCLSVLIVSLPFALFQYRAY

IQFCSPGSAPSIPEPLLQLAADKGYRLAGENAPPWCSWDLPLIYNYIQDVYWNVGLLRYYELKQVPNFLLATPVTVLVVWATWTYVTTHPWLCLTLGLQR

TKDRENPEKPHRGFLSPKVFVYLVHAAALLVFGGLCMHVQ - UNI14099 - - UNI30197 - VLTRFLASSTPIMYWFPAHLLQDQEPLLRCVDT

EPGKLPQEKSPPGQKAPRNCLMKLFYDWKRCSPVTRCVLVYFLTYWLLGLILHCNFLPWT
Transcript ENSMUST00000067902
Sequence
AGTTGGAGCTCCGCGGGGGTGGTCTGGACGCGCGGGCGCGGAGGATCCGGCGCCAGCTCTGCAACTCTGGAGTCCTCCGGGGAGGGAAGCTGTCAAACGC

AGGCCGAGAGAAATTAGGCGGAGGCTGTAGAGAAGCGAGGAGCCCCGCCCCTCCGCCATAGCAGCCTCCGGCGCCGCCTCTTCCTTTGCAGCCTCCGGCC

CTCGTCTGCTTCCGGCCCCGTTGCCTGGCCCGGCCCCGCGATTCCCCCGGGACGAAGCCCTGGGCCGTGGCTCCCTTGGG - UNI8531 - - UNI30

197 - AATTTAGAAGCCGGAGGAAGCTCAGTCCTGGTGGTGAGAGAGAGGATGGGACTCCTGGACCCATCCCAGAAAGAGGTGCTGAGATTCGCAGTAA

ACTGCCGCATCCTGACTCTAGTGCTACAG - UNI14099 - - UNI30197 - GTTCTCACGCGGTTTTTGGCCTCTTCCACTCCTATCATGTACTG

GTTTCCAGCTCACCTGCTTCAGGATCAAGAACCGCTGCTGAGGTGTGTGGACACAGAGCCTGGGAAGCTTCCTCAGGAGAAGTCCCCACCAGGACAGAAG

GCCCCCAGAAACTGTCTCATGAAACTCTTCTACGATTGGAAGAGATGCTCTCCAGTCACAAGATGCGTTCTGGTCTACTTCCTGACCTACTGGCTTCTGG

GACTAATTCTCCATTGCAACTTCCTGCCTTGGACTTGACCTGGAGTGTCAAGGAATGAAAGCTCTAAGACGACACCCTGGCTGGGACAGCCCGCACACTC

CGGAGAGCACTGTGCAGTAGGATCTCTGGGTCTCTCTGGGGGCCAGCTAAGAAGGGAAAATGGGAGCACAGGCGCCCCTTCTCATCCTGGGCGGGGCAGG

TGTAGGGGAGTAACTTCAGTGCTCAGTGCAGGGGTCTCAGATCTCCCTAGTCCACAAGTACTAGGCAATCTTAAACCTACTACTGATCCACGTGTAAGTC

TGTCTTCTTGTTTTTTGAGAGAAGGTTGGTTTCTCTACATTGCCCTGGTTGTCCTGGAACTCACTCTGTAGACCAAGTTTATGTAGACCAGGCTGGCCTT

GAACTCAGAGATTCATCTGCCTCTGCCTCTTGAGTACTAGGCCCACCACTGAGTGTGAGCCACCCCTGCCTGGCCTGGTGGATAAATTTAAATGTTTGAT

CAAAGCACAGGCCAACAGCCTGCCCCACTCAGGATGGTGGAGTCAGTGCAGTGTAGTGACAGAAGGAAGAGGGGACAGACAGCCTGCTCTAAGTGAGAGG

TTTCTGAAGGTGGTTGTTTTCTTTTTTTTTTTTTTTAAAGATGTATTATATTATATATGAGTACACTAGCTGTCTTCAGACACACCAGAAGAGGGCATCA

GATCCCATTGCAGATGGTTGTGAGCCACCATGTGGCTGCTGGGAATTGAACTCAGGACCTCTGGAAGAGCAGCCAGTGCTCTTAACCACTGAGCCATCTC

TCCAGCTCCCTGAAGTTTTCTTTATGATACTGGTGTGTGTGTGTCTGTGTCTATCCTACAGACTGTGAAAATCTAAATACTCCTTTTGCAATGAATTACC

TTTTTCTGGAGGAGGGGTAGTCAGGGGAGCTAAGACAAGGTCCCTCTGTGTAACTCTGACTGTCCTAGAACTTGCTTGCTATGTAGATCTGGCTGGTTTT

GAACTCAGAGATCCTCCTACCTCTGCCGAACTAGTTTCTATAAATTATAGAGGGTTGAGGCTAGAACTCCGTAGTAAAGCACACGAGGCCCTAATTTCAG

TAATAAACACCACTTGGATC
Translation
 - UNI8531 - - UNI30197 - MGLLDPSQKEVLRFAVNCRILTLVLQ - UNI14099 - - UNI30197 - VLTRFLASSTPIMYWFPAHLL

QDQEPLLRCVDTEPGKLPQEKSPPGQKAPRNCLMKLFYDWKRCSPVTRCVLVYFLTYWLLGLILHCNFLPWT

For any suggestions or comments, please send an email to unitrap@crg.es