Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000043301 (Kcnj6)
Chromosomal location
Chr 16: 94970290 - 95219303 (-)
Description
potassium inwardly-rectifying channel, subfamily J, member 6 Gene [Source:MGI Symbol;Acc:MGI:104781]
Human Ortholog
not available
Omim not available
UniTrap UNI38258
Vector Insertion
Chr 16: 94982686 - 95054827
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000056268
Sequence
GTGGTGCAGGCAGAACTGCTTGAATCCCAAA - UNI38258 - CTAACGTCTTGGAAGGCGATTCCATGGACCAGGATGTGGAAAGCCCAGTGGCCAT

TCACCAGCCAAAGTTGCCTAAGCAGGCCAGGGACGACCTGCCGAGACACATCAGCCGAGACAGGACCAAAAGGAAAATCCAGAGGTACGTGAGGAAGGAT

GGGAAGTGCAACGTTCACCACGGCAATGTGCGGGAGACGTACCGATACCTGACGGACATCTTCACCACCCTGGTGGACCTGAAGTGGAGATTCAACCTGT

TGATCTTTGTCATGGTCTACACAGTGACGTGGCTTTTCTTTGGGATGATCTGGTGGCTGATTGCGTACATCCGGGGAGATATGGACCACATAGAGGACCC

CTCGTGGACTCCTTGTGTCACCAACCTCAACGGGTTTGTCTCTGCTTTTTTATTCTCCATAGAGACAGAAACCACCATCGGTTATGGCTACCGGGTCATC

ACGGACAAGTGCCCTGAGGGGATTATTCTCCTCTTAATCCAGTCCGTGTTGGGGTCCATTGTCAACGCCTTCATGGTAGGATGTATGTTTGTGAAAATAT

CCCAACCCAAGAAGAGGGCAGAGACCCTGGTCTTTTCCACCCACGCGGTGATCTCCATGCGGGATGGGAAACTGTGCTTGATGTTCCGGGTGGGGGACTT

GAGGAATTCTCACATTGTGGAGGCATCCATCAGAGCCAAGTTGATCAAGTCCAAACAGACTTCAGAGGGGGAGTTTATTCCCCTCAACCAGACTGATATC

AACGTGGGGTACTACACAGGGGACGACCGGCTCTTTCTGGTGTCACCATTGATTATTAGCCATGAAATTAACCAACAGAGTCCCTTCTGGGAGATCTCCA

AAGCGCAGCTGCCTAAAGAGGAACTGGAGATTGTGGTCATCCTGGAGGGAATGGTGGAAGCCACAG - UNI38258 - GAATGACGTGCCAAGCCCGA

AGCTCCTACATCACCAGTGAGATCTTGTGGGGTTACCGGTTCACACCTGTCCTAACGCTGGAAGACGGGTTCTACGAAGTTGACTACAACAGCTTCCATG

AGACCTATGAGACCAGCACCCCGTCCCTTAGTGCCAAAGAGCTAGCGGAGCTGGCTAACCGGGCAGAGCTGCCTCTGAGTTGGTCTGTGTCCAGCAAACT

GAACCAACATGCAGAATTGGAGACAGAAGAGGAAGAGAAGAACCCGGAAGAACTGACGGAGAGGAATGGTGACGTGGCAAACCTAGAGAATGAATCCAAA

GTATAGGCCCAGCTGGGTCAGCCTCCCCCATCAGACATGACCCCTCCTTATAGGCTCAGCTGGGTCAGCCTCCCCCCTCAGATGACCCCTCCTTGTAGAC

TCAGCTGGGTCAGCCTCCCCTCTCAGACATGACTTCTCCTTGTCTCCCATTTCCTTCTTTTCTGTCTCTCTTACTTTGATCTTGATTCATTTGTATTTAA

TTTTGGCATTTCCAGAACACAAACCTTCAAGGTGTAAAATACCTACCTGCCCCTCTCAGATGTTCAGATGGGACAAGCAGACAGATATTTGGTGAAGGTA

CAATGTACCTTCATTGTGCCCAAGCCTAGTCTCCACTCACAGAAGAGACTACTTAATCCTCTTTACTATCCAATACGAATCATTCAAAAGAGCTGTCAGA

GTTTTACCCAGTGTCACAAAGAACATGACCTGTTTACCATGCCCTCGGGTCATGCAGAGAAGCCCCTTGGTTTTACAGAGCCCAGTCCATCTTACCTAGC

ACAGGGCAGGTACTTGACCACACAGACACTGACAGTACAGGACCCAGATGAGCCAAGGATAGACCACTGTACATAGATCTGCCCTATGGAATTATTTTCT

CTCGGCGAGTAGAGACAAACCCAGCATGCACAAAAGTACTATGGAGCAGAAATCCTAATAATTAATGTACATAGACATATCATTCATGTAGCTTTAGATT

TATAACTTTAGAAATAAGAAGAAAAAAGACTCCCAATGTACAGTAGGCGTTTCTGTTTTGATATCTGAGTCTTCTAATTATTTTTGATCCCCTTGACTGC

TGGCCCTCTAAATGCATGGCCTTTGTTCCAGGTCCCCCAGACTGACAGTTTTTAGGGCACCTCTCTGTTCCCTTGTCATCCTTAAGTTGAATCTAATAAG

CCATAGGTCTGGGGACAGTCTGGAGGTGTAAAAAGATGTCCACCATCCAAAATGCTGATAAACCATGACACATTTACGAAACGGGTGTCATTGTTTATAG

ATAATGTGGGACTCTCTGAGCACCCTTGAGAGGCTCTACCAGGAACAGGACTCTAGCACAGCCCCAGATGACATTTCCAGTGAAATATAGCAGTTTAAGA

AACCTTTCTGTGAAAGCATTGATTGCTTTTTTATGTAGTCATGAGAGACTGCAGAATGTCCATGGAGCTGTCTAGTCGACAGAAGACTTGTGGGAAAGGC

CATGGCATTCAGGAAGGCCCTGTGGGTGAAATGACAGGACTACATTGCCAGCTTCCTGCTCTCTCACTTCATCTAGCAAGTCTGCC
Translation
VVQAELLESQT - UNI38258 - TNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKDGKCNVHHGNVRETYRYLTDIFTT

LVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGDMDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSIVNA

FMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEI

NQQSPFWEISKAQLPKEELEIVVILEGMVEATG - UNI38258 - GMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAK

ELAELANRAELPLSWSVSSKLNQHAELETEEEEKNPEELTERNGDVANLENESKV
Transcript ENSMUST00000099508
Sequence
TGGAACCGAGTAGCATTCGTTGAATCTGCGGCTTTCATGACGTCTCCCTGCAAGGTCTATCACTTTGCTCCTAAACGAGGATTTATTCCCTCTGCCACTC

AAGGCTGTCCCCCAGTTTCCTCGCAACCGGGCTTCCTCCTCAGTCCCTGCCCACACGCGCACTCCTCTGCCCCGCGGTGGCCCCAGCGCCCAGCCCTCCA

GCCAGAGGGAGCCAGTCACCAGACGGCAGCACCTGGCTGGAGAGGTTGGGCGGGCCGAGGGTGGGGATCCGCGGGAACCGGCGAGTCGGAGCTGGAGCAG

GAGCTGGACCCAACCGCTAGCAGCAGAATGGAGTCTCCTGAAAGCCTGCCGGGGCTGATGTGAAATTGGACCATCTGCTTCCAGTTGGTCTGTTTCCTCC

TTTTCTTGTATTTTCTTCCCTCGCCATTCACCGTGGAGTGAATTATTGAATCTTGCTCCGTTCCGAGAGAGGCGATCAGGATGGAGTGAACCTACCCTGT

CCACTACAAG GAAAAGCACAAAGAAGAAATGACAATGGCCAAGTTAACTGAATCCATGA - UNI38258 - CTAACGTCTTGGAAGGCGATTCCATG

GACCAGGATGTGGAAAGCCCAGTGGCCATTCACCAGCCAAAGTTGCCTAAGCAGGCCAGGGACGACCTGCCGAGACACATCAGCCGAGACAGGACCAAAA

GGAAAATCCAGAGGTACGTGAGGAAGGATGGGAAGTGCAACGTTCACCACGGCAATGTGCGGGAGACGTACCGATACCTGACGGACATCTTCACCACCCT

GGTGGACCTGAAGTGGAGATTCAACCTGTTGATCTTTGTCATGGTCTACACAGTGACGTGGCTTTTCTTTGGGATGATCTGGTGGCTGATTGCGTACATC

CGGGGAGATATGGACCACATAGAGGACCCCTCGTGGACTCCTTGTGTCACCAACCTCAACGGGTTTGTCTCTGCTTTTTTATTCTCCATAGAGACAGAAA

CCACCATCGGTTATGGCTACCGGGTCATCACGGACAAGTGCCCTGAGGGGATTATTCTCCTCTTAATCCAGTCCGTGTTGGGGTCCATTGTCAACGCCTT

CATGGTAGGATGTATGTTTGTGAAAATATCCCAACCCAAGAAGAGGGCAGAGACCCTGGTCTTTTCCACCCACGCGGTGATCTCCATGCGGGATGGGAAA

CTGTGCTTGATGTTCCGGGTGGGGGACTTGAGGAATTCTCACATTGTGGAGGCATCCATCAGAGCCAAGTTGATCAAGTCCAAACAGACTTCAGAGGGGG

AGTTTATTCCCCTCAACCAGACTGATATCAACGTGGGGTACTACACAGGGGACGACCGGCTCTTTCTGGTGTCACCATTGATTATTAGCCATGAAATTAA

CCAACAGAGTCCCTTCTGGGAGATCTCCAAAGCGCAGCTGCCTAAAGAGGAACTGGAGATTGTGGTCATCCTGGAGGGAATGGTGGAAGCCACAG - UN

I38258 - GAATGACGTGCCAAGCCCGAAGCTCCTACATCACCAGTGAGATCTTGTGGGGTTACCGGTTCACACCTGTCCTAACGCTGGAAGACGGGTT

CTACGAAGTTGACTACAACAGCTTCCATGAGACCTATGAGACCAGCACCCCGTCCCTTAGTGCCAAAGAGCTAGCGGAGCTGGCTAACCGGGCAGAGCTG

CCTCTGAGTTGGTCTGTGTCCAGCAAACTGAACCAACATGCAGAATTGGAGACAGAAGAGGAAGAGAAGAACCCGGAAGAACTGACGGAGAGGAATGGTG

ACGTGGCAAACCTAGAGAATGAATCCAAAGTATAGGCCCAGCTGGGTCAGCCTCCCCCATCAGACATGACCCCTCCTTATAGGCTCAGCTGGGTCAGCCT

CCCCCCTCAGATGACCCCTCCTTGTAGACTCAGCTGGGTCAGCCTCCCCTCTCAGACATGACTTCTCCTTGTCTCCCATTTCCTTCTTTTCTGTCTCTCT

TACTTTGATCTTGATTCATTTGTATTTAATTTTGGCATTTCCAGAACACAAACCTTCAAGGTGTAAAATACCTACCTGCCCCTCTCAGATGTTCAGATGG

GACAAGCAGACAGATATTTGGTGAAGGTACAATGTACCTTCATTGTGCCCAAGCCTAGTCTCCACTCACAGAAGAGACTACTTAATCCTCTTTACTATCC

AATACGAATCATTCAAAAGAGCTGTCAGAGTTTTACCCAGTGTCACAAAGAACATGACCTGTTTACCATGCCCTCGGGTCATGCAGAGAAGCCCCTTGGT

TTTACAGAGCCCAGTCCATCTTACCTAGCACAGGGCAGGTACTTGACCACACAGACACTGACAGTACAGGACCCAGATGAGCCAAGGATAGACCACTGTA

CATAGATCTGCCCTATGGAATTATTTTCTCTCGGCGAGTAGAGACAAACCCAGCATGCACAAAAGTACTATGGAGCAGAAATCCTAATAATTAATGTACA

TAGACATATCATTCATGTAGCTTTAGATTTATAACTTTAGAAATAAGAAGAAAAAAGACTCCCAATGTACAGTAGGCGTTTCTGTTTTGATATCTGAGTC

TTCTAATTATTTTTGATCCCCTTGACTGCTGGCCCTCTAAATGCATGGCCTTTGTTCCAGGTCCCCCAGACTGACAGTTTTTAGGGCACCTCTCTGTTCC

CTTGTCATCCTTAAGTTGAATCTAATAAGCCATAGGTCTGGGGACAGTCTGGAGGTGTAAAAAGATGTCCACCATCCAAAATGCTGATAAACCATGACAC

ATTTACGAAACGGGTGTCATTGTTTATAGATAATGTGGGACTCTCTGAGCACCCTTGAGAGGCTCTACCAGGAACAGGACTCTAGCACAGCCCCAGATGA

CATTTCCAGTGAAATATAGCAGTTTAAGAAACCTTTCTGTGAAAGCATTGATTGCTTTTTTATGTAGTCATGAGAGACTGCAGAATGTCCATGGAGCTGT

CTAGTCGACAGAAGACTTGTGGGAAAGGCCATGGCATTCAGGAAGGCCCTGTGGGTGAAATGACAGGACTACATTGCCAGCTTCCTGCTCTCTCACTTCA

TCTAGCAAGTCTGCC
Translation
 MTMAKLTESMT - UNI38258 - TNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKDGKCNVHHGNVRETYRYLTDIFT

TLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGDMDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSIVN

AFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHE

INQQSPFWEISKAQLPKEELEIVVILEGMVEATG - UNI38258 - GMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSA

KELAELANRAELPLSWSVSSKLNQHAELETEEEEKNPEELTERNGDVANLENESKV
Transcript ENSMUST00000095873
Sequence
TGGAACCGAGTAGCATTCGTTGAATCTGCGGCTTTCATGACGTCTCCCTGCAAGGTCTATCACTTTGCTCCTAAACGAGGATTTATTCCCTCTGCCACTC

AAGGCTGTCCCCCAGTTTCCTCGCAACCGGGCTTCCTCCTCAGTCCCTGCCCACACGCGCACTCCTCTGCCCCGCGGTGGCCCCAGCGCCCAGCCCTCCA

GCCAGAGGGAGCCAGTCACCAGACGGCAGCACCTGGCTGGAGAGGTTGGGCGGGCCGAGGGTGGGGATCCGCGGGAACCGGCGAGTCGGAGCTGGAGCAG

GAGCTGGACCCAACCGCTAGCAGCAGAATGGAGTCTCCTGAAAGCCTGCCGGGGCTGATGTGAAATTGGACCATCTGCTTCCAGTTGGTCTGTTTCCTCC

TTTTCTTGTATTTTCTTCCCTCGCCATTCACCGTGGAGTGAATTATTGAATCTTGCTCCGTTCCGAGAGAGGCGATCAGGATGGAGTGAACCTACCCTGT

CCACTACAAG GAAAAGCACAAAGAAGAAATGACAATGGCCAAGTTAACTGAATCCATGA - UNI38258 - CTAACGTCTTGGAAGGCGATTCCATG

GACCAGGATGTGGAAAGCCCAGTGGCCATTCACCAGCCAAAGTTGCCTAAGCAGGCCAGGGACGACCTGCCGAGACACATCAGCCGAGACAGGACCAAAA

GGAAAATCCAGAGGTACGTGAGGAAGGATGGGAAGTGCAACGTTCACCACGGCAATGTGCGGGAGACGTACCGATACCTGACGGACATCTTCACCACCCT

GGTGGACCTGAAGTGGAGATTCAACCTGTTGATCTTTGTCATGGTCTACACAGTGACGTGGCTTTTCTTTGGGATGATCTGGTGGCTGATTGCGTACATC

CGGGGAGATATGGACCACATAGAGGACCCCTCGTGGACTCCTTGTGTCACCAACCTCAACGGGTTTGTCTCTGCTTTTTTATTCTCCATAGAGACAGAAA

CCACCATCGGTTATGGCTACCGGGTCATCACGGACAAGTGCCCTGAGGGGATTATTCTCCTCTTAATCCAGTCCGTGTTGGGGTCCATTGTCAACGCCTT

CATGGTAGGATGTATGTTTGTGAAAATATCCCAACCCAAGAAGAGGGCAGAGACCCTGGTCTTTTCCACCCACGCGGTGATCTCCATGCGGGATGGGAAA

CTGTGCTTGATGTTCCGGGTGGGGGACTTGAGGAATTCTCACATTGTGGAGGCATCCATCAGAGCCAAGTTGATCAAGTCCAAACAGACTTCAGAGGGGG

AGTTTATTCCCCTCAACCAGACTGATATCAACGTGGGGTACTACACAGGGGACGACCGGCTCTTTCTGGTGTCACCATTGATTATTAGCCATGAAATTAA

CCAACAGAGTCCCTTCTGGGAGATCTCCAAAGCGCAGCTGCCTAAAGAGGAACTGGAGATTGTGGTCATCCTGGAGGGAATGGTGGAAGCCACAG - UN

I38258 - GAATGACGTGCCAAGCCCGAAGCTCCTACATCACCAGTGAGATCTTGTGGGGTTACCGGTTCACACCTGTCCTAACGCTGGAAGACGGGTT

CTACGAAGTTGACTACAACAGCTTCCATGAGACCTATGAGACCAGCACCCCGTCCCTTAGTGCCAAAGAGCTAGCGGAGCTGGCTAACCGGGCAGAGCTG

CCTCTGAGTTGGTCTGTGTCCAGCAAACTGAACCAACATGCAGAATTGGAGACAGAAGAGGAAGAGAAGAACCCGGAAGAACTGACGGAGAGGAATG - 

UNI38258 - GGTGATGCTGGGCTCCTAGTGTGGATCAAGAAGTGTTCCTTCTAAGCTCATCCTCTGACAGACATTACAGAGAACTGATATATTTTTCC

TCCTTCACTGCTTGGAAGAATTCACCCAGAATTCACCCAACCCATCTGGACCTAGTACATTCTGTTTGGGAAGGTCATCAATAATTTACTTAAAGTCGGG

GCTGGAGAGATGACGCCGCGGTTAAGATGGTTTATTGCTCTTGCAGACGGCCTGGGTTCAGTTCCCGGTGCACACGTGGTGGCTCACAATCACCTAGGAC

TCCAGTTCCGAGGGACCTGGCACCTTCTTCTGGCTCCCATGGGCTACTGCATGTGTGAGATGCACAAAAGCTCACGCAGGCATCCAGACTCCTGCACAAA

AATAAACGGAAACAAAACTTTGAAGTCTCTAATGTATAGACCTTTCAGGCTATCTATGTCTTCTAATGTGAGTTTTGAAAGACTGAATGTTTCTAGTACT

GATTGTACTTCCCCCACGCAGAGACGTGTGGACACGCCCTTTGGGGTCCTTTCTATGGCCGCAGGGTCTGTTGTGTTCCCTGACAATTCTGCAGTTCTT
Translation
 MTMAKLTESMT - UNI38258 - TNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVRKDGKCNVHHGNVRETYRYLTDIFT

TLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIRGDMDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLGSIVN

AFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHE

INQQSPFWEISKAQLPKEELEIVVILEGMVEATG - UNI38258 - GMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSA

KELAELANRAELPLSWSVSSKLNQHAELETEEEEKNPEELTERNG - UNI38258 - G

For any suggestions or comments, please send an email to unitrap@crg.es