Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000043333 (Rhbdl2)
Chromosomal location
Chr 4: 123465118 - 123507147 (+)
Description
rhomboid, veinlet-like 2 (Drosophila) Gene [Source:MGI (curated);Acc:Rhbdl2-001]
RefSeq_dna
NM_183163 
RefSeq_peptide
NP_898986.2 
UniGene
Mm.426060 
MGI
MGI:3608413 
Uniprot/SPTREMBL
A2AGA4 
Human Ortholog
ENSG00000158315 (RHBDL2)
Omim not available
UniTrap UNI33336
Vector Insertion
Chr 4: 123465215 - 123487156
Public Clones IST12638E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000053202
Sequence
TGGCAGGCTGCGGCTCGGGCCTCCAGGCAGCTCCGTTGGCTGCTTGAAGTGCAAGATCCGACTGCAGTGTGGGACCACTGTGCCTCGGCCTCCCCAG - 

UNI33336 - GCGGAGGGAGGACCCAGACAATGGCTGTTGCTCACGAGATGGAGATGGAGAGTGTGAATCTGAACATGGAGAGAGAGGGAAAGGAAGAA

CCGGAGGAGGAGAAAATGAAAGGGAATGGAGAAGGTAAAGACTTCCCCAGGAGCAGAAAGGTCCACAGGATCGTCTCCAAGTGGATGCTTCCTGAGCCAG

TCCGAAGAACATACTTAGAGAGAGCCAACTGCCTCCCGCCGCCCCTGTTCATCATCCTCATCAGTCTGGCTGAG CTGGCTGTGTTTATTTATTATGCGG

TGTGGAAGCCACAGAAGCAGTGGATCACCCTGGACACGGGGATCTTGGAAAGTCCCTTGACGTACTGCCCTGAGAAGAGGGAGGAAGCCTGGAGGTTTAT

CTCATACATGCTGGTCCATGCCGG AGTCCAGCACATCGTGGGGAATCTTCTTATGCAGATCGTCCTGGGTATTCCTTTGGAAATGGTCCACAAAGGCCT

CCGAGTGGGGCTGGTGTACCTGGCAGGAGTGCTTGCAG GTTCCCTGGCCAGCTCCATCTTTGACCCCCTCAAGTCTCTTGTGGGAGCTTCAGGAGGAGT

CTATGCATTGATGGGAGGATATTTTATGAATGTTATAGTG AACTTTCGAGAAATGATTCCTGCCTTTGGAATCGTCAGACTACTCGTTATCATTCTGAT

AG TTGCGTCAGACATGGGATTTGCTCTCTACAGAAGATTCTTTGTCCCTGCAAATGGGTCTCCG GTGTCCTTTGCTGCTCACATTGCAGGTGGATTTG

CTGGGATGTCCATAGGTTACACTGTGTTCAGCTGCTTTGACAAGACCCTGCTCAAAGACCCCAGGTTCTGGATCGCAATTGCTGCATATGTAGCTTGTCT

CTTATTTGCTGTGTTTTTTAACATCTTTCTGTCCCCAGCAAACTGACTTGCCTCTATGATAAACCAGTTAATATAAAAGTGTCACATGGGACCAGGTGTG

GTGGCACACGCCTTTAATCCCAGCACTCGGGAGGCAGAGGCAGGCGGATTTCTGAGCTTGAGGCCAGCCTGGTCTACAAAGTGAGTTCCAGGTCAGCCAG

GGCTACACAGAAAAACCCTGTCTCAAAACCCCCCCCC
Translation
 - UNI33336 - MAVAHEMEMESVNLNMEREGKEEPEEEKMKGNGEGKDFPRSRKVHRIVSKWMLPEPVRRTYLERANCLPPPLFIILISLAE LAVF

IYYAVWKPQKQWITLDTGILESPLTYCPEKREEAWRFISYMLVHAG GVQHIVGNLLMQIVLGIPLEMVHKGLRVGLVYLAGVLAG GSLASSIFDPLKS

LVGASGGVYALMGGYFMNVIV NFREMIPAFGIVRLLVIILIV VASDMGFALYRRFFVPANGSP VSFAAHIAGGFAGMSIGYTVFSCFDKTLLKDPRF

WIAIAAYVACLLFAVFFNIFLSPAN
Transcript ENSMUST00000106204
Sequence
GCGGAGGGAGGACCCAGACAATGGCTGTTGCTCACGAGATGGAGATGGAGAGTGTGAATCTGAACATGGAGAGAGAGGGAAAGGAAGAACCGGAGGAGGA

GAAAATGAAAGGGAATGGAGAAGGTAAAGACTTCCCCAGGAGCAGAAAGGTCCACAGGATCGTCTCCAAGTGGATGCTTCCTGAGCCAGTCCGAAGAACA

TACTTAGAGAGAGCCAACTGCCTCCCGCCGCCCCTGTTCATCATCCTCATCAGTCTGGCTGAG CTGGCTGTGTTTATTTATTATGCGGTGTGGAAGCCA

CAGAAGCAGTGGATCACCCTGGACACGGGGATCTTGGAAAGTCCCTTGACGTACTGCCCTGAGAAGAGGGAGGAAGCCTGGAGGTTTATCTCATACATGC

TGGTCCATGCCGG AGTCCAGCACATCGTGGGGAATCTTCTTATGCAGATCGTCCTGGGTATTCCTTTGGAAATGGTCCACAAAGGCCTCCGAGTGGGGC

TGGTGTACCTGGCAGGAGTGCTTGCAG GTTCCCTGGCCAGCTCCATCTTTGACCCCCTCAAGTCTCTTGTGGGAGCTTCAGGAGGAGTCTATGCATTGA

TGGGAGGATATTTTATGAATGTTATAGTG AACTTTCGAGAAATGATTCCTGCCTTTGGAATCGTCAGACTACTCGTTATCATTCTGATAG TTGCGTCA

GACATGGGATTTGCTCTCTACAGAAGATTCTTTGTCCCTGCAAATGGGTCTCCG GTGTCCTTTGCTGCTCACATTGCAGGTGGATTTGCTGGGATGTCC

ATAGGTTACACTGTGTTCAGCTGCTTTGACAAGACCCTGCTCAAAGACCCCAGGTTCTGGATCGCAATTGCTGCATATGTAGCTTGTCTCTTATTTGCTG

TGTTTTTTAACATCTTTCTGTCCCCAGCAAACTGACTTGCCTCTATGATAAACCAGTTAATATAAAAGTGTCACATGGGACCAGGTGTGGTGGCACACGC

CTTTAATCCCAGCACTCGGGAGGCAGAGGCAGGCGGATTTCTGAGCTTGAGGCCAGCCTGGTCTACAAAGTGAGTTCCAGGTCAGCCAGGGCTACACAGA

AAAACCCTGTCTCAAAACCCCCCCCC
Translation
MAVAHEMEMESVNLNMEREGKEEPEEEKMKGNGEGKDFPRSRKVHRIVSKWMLPEPVRRTYLERANCLPPPLFIILISLAE LAVFIYYAVWKPQKQWIT

LDTGILESPLTYCPEKREEAWRFISYMLVHAG GVQHIVGNLLMQIVLGIPLEMVHKGLRVGLVYLAGVLAG GSLASSIFDPLKSLVGASGGVYALMGG

YFMNVIV NFREMIPAFGIVRLLVIILIV VASDMGFALYRRFFVPANGSP VSFAAHIAGGFAGMSIGYTVFSCFDKTLLKDPRFWIAIAAYVACLLFA

VFFNIFLSPAN

For any suggestions or comments, please send an email to unitrap@crg.es