Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000043384 (Gprasp1)
Chromosomal location
Chr X: 132277272 - 132338013 (+)
Description
G protein-coupled receptor associated sorting protein 1 Gene [Source:MGI (curated);Acc:Gprasp1-001]
RefSeq_dna
NM_001004359 NM_001005385 NM_026081 
RefSeq_peptide
NP_001004359.1 NP_080357.4 NP_001005385.1 
UniGene
Mm.475510 Mm.475515 Mm.271980 
MGI
MGI:1917418 
Uniprot/SWISSPROT
Q5U4C1 
Uniprot/SPTREMBL
A2AGB6 Q6PD32 
Human Ortholog
ENSG00000198932 (GPRASP1)
Omim not available
UniTrap UNI1099
Vector Insertion
Chr X: 132286557 - 132330680
Public Clones CE0057 (sanger) 3SD181G05 (ggtc) IST13201B6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113147
Sequence
GTAGTCGCTTCGTGAGGGACCGGAGAGAGGAGTGGGTACCGAAAGGTGACAGTAATTTGCTAGTCATGGCCCTTCATCTTGTCCTACATCCCAAGCTCCC

GGCAAGCCCCTAAATTACAGTCGCCGCCATTGCCTCTGCTCCCTGCGGCGGACTGCCGACGGCGTTTGCCTGCCTCCTTTCTGTGTGGGAAGGCGCCGCC

GGAGAGAACGCACCTAAGAAAACTGCCTTGGATTCAAGCAGAACAG CCTTCCAGAAATGCCCTCCGCGTTACCCCAACTATGTTGCAGAATGTGATAG 

GTTTGCCAGATCTGCTGCAGGGCTTGTCGCCAGTGGAAACAGAGAAAGGAGGAAACAATCCCTTGGCAAGAGCGCAG ATCTCCCCTAGCCTAGAATACC

AGCTGTGAGCACTTCTCTCAGTGGAGATCTTCATAGTGCAATCGGACCAAATCCTCTGGAAACATTCTGTATCTCAAATGCCCCGTGGAGTACACTCTTA

CCCAG ACCAACAGCAACCACCACTGCTCTTAAGACAGGTGGACCATCCTGTGGCTGCATTGTTCAACCATTTGAACAG - UNI1099 - CCCTGCTT

TAAGGCTGGTCAGTTCTTCAAGCAAGGGAAGAAGGCTTCAAGGCGACTGTCTCAAATCTCTGGAGATTG CCCTGCTTTAAGGCTGGTCAGTTCTTCAAG

CAAGGGAAGAAGGCTTCAAGGCGACTGTCTCAGATCTCTGGAGATTG TCCTGCTTTAAGGCTGGTCAGTTCTTCAAGCAAGGGAAGAAGGCTTCAAGGC

GACTGTCTCAGATCTTGGAG GACTCCCTGCAGTGAGTCAGCTGTTGGTCTTTAACACCACTTGAACGCAGAGAAGAGGGGAGACCTGCACCACATCTGT

GAAG GTCGCCTGCCGTGGCTGCTTGGTGGTGCTGAGGTTGCTGCTGACCAGTGCAATCATCAGGTCTGCACTCACCCAGGACCTGTCCATCGTCCTCCA

GCTTGATTTCAGCTCTTCTGCAGTGTATCTGTGTTATTGACTGAGACTGCTTGGGTAGGAGCCTCACTGAGTGCTGAATTGTCATTTCAGGCTAATTCTT

TGTAATCTCATACCCTCACTTATCTAAGATCGTCGTGCAGAGCTATCCTGTAACAGATCTCTAGTGAAGGCTCACTGTTGTTAAGTCATATACAGTAGAC

TTGATTGAACTTGTACTATGACTAGGGCAGAGGTTGAGCCTGGTGCCCAGGCAAAGGCTGAAAATAAGCCTGGGGATGAGAATGCTAATGCTGCTGAAGT

AGAGCCTGAAGCCCCATTGGTGGTCAGACCCAAGGTTAGGACACAAATCATGACTGGAGCAAGGCCCAAAGTGAAGCCTAAGGGTACCCCTGGAGCAAGA

CCTAAAGGTGAAACCAGTACACCAGGTGGGGCATATGCCAAATGTAAACCTAAGGCAATCCCTATTGCTCGATCCAAGCATGATGCCCAAGTGTGGGCCC

CAAATAAGTTTCGTGGCGAGTCCATGTCAAAGATGGGAAAGCAATGTCAGATCAGTGCTGCAGACCCTCCACTGCTCAGTAATGATTCTGGGATGGTTGC

TCAAGCTAAGTGCCTGCCTGTAGATAGAGAACTTGCTAATATGGACACTGAGAGTATTCCCAAAAAGGCTAATTCTCCAGCTGGATTCCAGCCTTCCTAT

GGCTCAGAGGAGGGAACCAATATGGGGTCCTGGTACCGTGCCAGGCCTGTCCCCAAAGGAGAGGCCTATGAGAATTCCGATTTCAAATGGGCAGATAAAC

CCTCAGGAAGTCCCTCCTTTTGGAATAGAGATGAAGCCAGTACAAGATTTCGTCCTAGGAAAAGCATGAAGGCCAATAACAGGTTCAGGCATATGGCCAA

ACAAGAGGCAAATACCATGCCTAGGCACAAAAACAAACAAGAGTTCTATAATATTTCCAGTTCTGATTCTGAGGATGAGTCTGGTAAAACTCCCTGGTTC

TGGCCCAAAGACAAGACCAAAGTCTGGTCTAAGCCCAAAGAAGAGCCCAATAGTAGGTCCTGGTTTAGGTCTAAGAAAGAAGTCCGTGTTGAATCCACTT

CTGGGTCTGAATGTGAAAATCCTACAAAATCTTTGTTTTGGTCTGGAGAAGAGGCTAAATCTAGATCCAAACCCAGAGCCAGGAAAGGGGTCAATATGAG

GGCCAGGCAGCAGGCCAAGCGAGAAGCTTGCAGTGATGCCATGTCTGGAGCTATAGATACAAATAAGAAAGAGTCCTGGTTCTTGCCTGAAGAGAAAGCT

AATGTTTTTTCAAAGTCTAAGACAAAGAAAGAGCCCAGAACCAGAGCAGTGCCAAAGGAAGAAGTCAAAACTAAGGCCAGAGCAAGTACCAAGCAAGAAG

CCAGGCCAGAGGAGGAAGTCCTCGTTGGGGCTTGGTTCTGGGACACCCAGGAGTCCACTATGGCAGATAGGATAAGCATCAAGACCACTTTTGTAGAGGA

GGAGCCCATTGTTGGAGATTGGTTCTGGAGTGAAGAAGAAGCCAGTGTGGACTCTGAGACCTGTCATACATCCAGACCCAGGGCTAAGGAGGAGCAAGTT

AGTAGTTTCTGTTTAGGGTCTGGAAAGAAGAGCAGTATGGAAAGTGGGCCAAAGGCTACTTCTAAATCTATGCCAGTAGCTAAGGAGGATGAGGTCGTTA

TTGGGTCCTGGTTCTGGGCAGATGATGAAGAGATCAACTTACAGGCTGATGACGAGTCTATTTTTGGATCTTGGTTCTGGGGCACTGGTGAGAACAGCCT

TAGATCTGTTGGAGTCAATTGTGAGAAGATGCCGAAGGCTGGAGAAAAAGAAGTTACTGATTCCTGGTTCTGGGCTGGAGATGTCAATACAGAGGCTGAG

GTTGAAGAACAGGCCAGGTCGGCATCTACAAAAGCAACAATCTTTGTGCCTTGGTTTTGGTCTGAAAAGCAGCCGAACATGGATTTAGGGTCTGAACCTT

GCTCAGATATCATGGCAGGAGCTGAGGAGGAGCCCATAATTGGGCCCTGGTTCTGGGCTAAAGTAGATAATAGTGTGGAGGCTGAAGTTAACAGTAAGTC

TAGCCTTGAGGATGAGGAAGAACCCATTAGATCCCCTTGGTTTGGGGCCAGAGAACAAACCGATATGAAGTATGCAGCTGGTATCAGATACAAGCCTATG

GCAGAAGCTGAGGATGCTAACAAAAAGTCTTGTGTCTGGGCAAAAGAACCCTGTTTGTATCCTACCAATAGAGAATGCTTGAAATCTACTCTGGGAGAAA

AAGAAGACACTGTTGATCCATGGCTCTGGTCCAATAATTATCCAAGGACCAAGACCATCACAGGGTCCTGGCTATGGGCTGCAGAAGAGGGAAATATAGA

TGATGAGACTGGAGAAAAGATTAAACTACCAACTTTAGAGGACAATGCATTCAATTCTTGGTTCTGGAAAGAAAATGAAGAAAGCATTGTAGAGGCTCCC

AAGAGAGAAGAATTCAGGCCAGAAGCGGAAGAGGAAGACATTATTGGTTCTTGGTTTTGGGCTGGGGATGAAGACAGGTTTGAGCCAGCTGCTAAGATTA

ATGAAGAGAACAAGATAGCATCTGAAGATGAAGATACAGTTGGATCCTGGTTCTGGGGCAATGAAGAGGCCAGTCTAGAGGCAGTGAGAAGGGGTACTTT

TGAGTCTGCTCCTGGGATTAAGGAAGAGAAAGTTACTGGGTCATGGTTCTGGACTGATAAGGCCAAAGTAGGGGCTGGGTCCCAGACTGTCGAAACTGGG

TCAGAAACTGAAGAGGAAGCAATTTTTGAGTCCTTGATCTGGGCTGCAAAAAAGGACAGTATTCAAGCAGGAGTAAAGCGTGTGTCCAAGCCAAAAGATG

ACGGTAACATAGCTGTTGGGTCCTGGCTCTGGTCTAGTGACAAGGCCACAAAAGAAGCTAAAACTCTGATTGTCAGTGAGGCCAGTCCAGAAAATGGGAA

AGAGTCAGTTGTTAAGTTTGGGTCAAGAGCAAAAGATGAGGTGATTAACAAGACTGGCAGTGGTGACAATTGTAAACATAGTACAGAAGCTGAAACCATA

GTGGGAGCCTGGTTCTGGGAAGGAGATGAAGCTAGCTTTGAATCAAATCCTGTACCTGTATGCAAGGCCGTTTGTGAACCCGAGTCTTCAGCTGAGCACG

AACCTGACCCTTCCCGCAGGCCTCAGAGCTGGGATGAGGTCACTGTTCAGTTTAAGGCTGGTCCGTGGGGAAAAGCTGGCTTCCCACCCATGAACCCCTT

CAGATTCCCCAAAGAAGCGGCATCTCTGTTTGCAGAAATGTTTGGGGGAAAGCCTAAGCTTGTGGAAGTTGGTCCAGAAAGGGAGCCTGAACCCCAGTTC

CCATTTCAGTATGATCCCTCTTACCGCTCAGTCCGAGAAATTCGCGAGCATCTTAAGGCCAGGGAAAGTGCACAGCCAGAGAATTGGTCTTGCAACTGCA

TCCAGTGTGAGCTTAGAATTGGTTCTGAGGAGTTTGAGGAGCTTCTTTTACTGATGGACAGAAATCGTGATCCTTTTATCCATGAGATATCTAAGATTGC

AATGGGCATGCGAGGTGCTTCTCAGTTTACCCGGGATTTCATTCGAAACTCGGGCGTTGTCTCCCTGATTGAAGCCTTACTTAACTATCCGTCCTCCCGA

GTGAGGACAAGGTTTTTGGAAAATATGGTCCGCATGGCTCCCCCTTATCCAGACCTGAACATGATTGAGACATACGTGTGTCAGATTTGCGAGGACACCT

TTGACTATGACTTGGATTCCCCTGATCAGTTGTCCGGATTGACAATGATTACACACCTCACTGCTACTTCTGACTATCACAAGGTGGTTGTCAATTACTT

GGCTGGGTTTTTCTACTTACTGAATTCAGGCAATACCAAAACAAGGTTTCATGTTCTGAAACTGCTACTGAATTTGTCTGAAAACCTTGTCATGACAAAA

CGCCTACTTGTTACTGATTCGGTGTCAGAATTTATGGACCTTATTAATAGGGAGGAGTCAGATGAAAACATTCAAATTGTTCTTGCAATATTTGAGACTA

TCAGTAAACATATTCAAAAAGAGGCACTGTTTTCTGATGATGATGATGATGATGAAGAAGAAGATGCAGTGAATCTTGAACCATTTATTTCTGCATTCCG

TGAGGCTGAAAAAATTGCCAAGGAACTAAAACGCAAACCTGGCAATCAAAAAGCACCCTGAAGCAGTACAACAAAAACAAAAAGTAATTTGACTAACCCT

TTGCCTCCGGTTGTCCTTTTGTTCCTGAGTCATCTGACCCTCAAATACTGCTTTGCTTTCCCAGCTGCTTCCTTGTTTCAGTGTACCTCTCTAATGCTGG

TGGCAATTCTACCCAACCCTGTGTACTCTGTATTATCGTTCTGATGCCAAATGAAGATACAACTGAAAACACATGACACTTGTTGATGACGCTTGTTGTG

TTGATTGTGATGTTCAGTATTTGAGTGTAAAGTGAACTGAGCCGTTGTAAATAAGATGCCCTTCTAAATGTTGTTCTCGTGTATATTTGAGTCTTGTGCT

TCAATAAAGGTCTATGTGAAAGTGAGCAGAAA
Translation
     - UNI1099 -     MTRAEVEPGAQAKAENKPGDENANAAEVEPEAPLVVRPKVRTQIMTGARPKVKPKGTPGARPKGETSTPGGAYAKCKPK

AIPIARSKHDAQVWAPNKFRGESMSKMGKQCQISAADPPLLSNDSGMVAQAKCLPVDRELANMDTESIPKKANSPAGFQPSYGSEEGTNMGSWYRARPVP

KGEAYENSDFKWADKPSGSPSFWNRDEASTRFRPRKSMKANNRFRHMAKQEANTMPRHKNKQEFYNISSSDSEDESGKTPWFWPKDKTKVWSKPKEEPNS

RSWFRSKKEVRVESTSGSECENPTKSLFWSGEEAKSRSKPRARKGVNMRARQQAKREACSDAMSGAIDTNKKESWFLPEEKANVFSKSKTKKEPRTRAVP

KEEVKTKARASTKQEARPEEEVLVGAWFWDTQESTMADRISIKTTFVEEEPIVGDWFWSEEEASVDSETCHTSRPRAKEEQVSSFCLGSGKKSSMESGPK

ATSKSMPVAKEDEVVIGSWFWADDEEINLQADDESIFGSWFWGTGENSLRSVGVNCEKMPKAGEKEVTDSWFWAGDVNTEAEVEEQARSASTKATIFVPW

FWSEKQPNMDLGSEPCSDIMAGAEEEPIIGPWFWAKVDNSVEAEVNSKSSLEDEEEPIRSPWFGAREQTDMKYAAGIRYKPMAEAEDANKKSCVWAKEPC

LYPTNRECLKSTLGEKEDTVDPWLWSNNYPRTKTITGSWLWAAEEGNIDDETGEKIKLPTLEDNAFNSWFWKENEESIVEAPKREEFRPEAEEEDIIGSW

FWAGDEDRFEPAAKINEENKIASEDEDTVGSWFWGNEEASLEAVRRGTFESAPGIKEEKVTGSWFWTDKAKVGAGSQTVETGSETEEEAIFESLIWAAKK

DSIQAGVKRVSKPKDDGNIAVGSWLWSSDKATKEAKTLIVSEASPENGKESVVKFGSRAKDEVINKTGSGDNCKHSTEAETIVGAWFWEGDEASFESNPV

PVCKAVCEPESSAEHEPDPSRRPQSWDEVTVQFKAGPWGKAGFPPMNPFRFPKEAASLFAEMFGGKPKLVEVGPEREPEPQFPFQYDPSYRSVREIREHL

KARESAQPENWSCNCIQCELRIGSEEFEELLLLMDRNRDPFIHEISKIAMGMRGASQFTRDFIRNSGVVSLIEALLNYPSSRVRTRFLENMVRMAPPYPD

LNMIETYVCQICEDTFDYDLDSPDQLSGLTMITHLTATSDYHKVVVNYLAGFFYLLNSGNTKTRFHVLKLLLNLSENLVMTKRLLVTDSVSEFMDLINRE

ESDENIQIVLAIFETISKHIQKEALFSDDDDDDEEEDAVNLEPFISAFREAEKIAKELKRKPGNQKAP
Transcript ENSMUST00000113145
Sequence
GTAGTCGCTTCGTGAGGGACCGGAGAGAGGAGTGGGTACCGAAAGGTGACAGTAATTTGCTAGTCATGGCCCTTCATCTTGTCCTACATCCCAAGCTCCC

GGCAAGCCCCTAAATTACAGTCGCCGCCATTGCCTCTGCTCCCTGCGGCGGACTGCCGACGGCGTTTGCCTGCCTCCTTTCTGTGTGGGAAGGCGCCGCC

GGAGAGAACGCACCTAAGAAAACTGCCTTGGATTCAAGCAGAACAG GGCGGCAGATCAAAAGGGGAGGGGAGAAGATAAACAAAACTGACCTGATTTCT

GTACTGTGGGAGAAAGCTGCAAGACTAG GTTTGCCAGATCTGCTGCAGGGCTTGTCGCCAGTGGAAACAGAGAAAGGAGGAAACAATCCCTTGGCAAGA

GCGCAG ATCTCCCCTAGCCTAGAATACCAGCTGTGAGCACTTCTCTCAGTGGAGATCTTCATAGTGCAATCGGACCAAATCCTCTGGAAACATTCTGTA

TCTCAAATGCCCCGTGGAGTACACTCTTACCCAG ACCAACAGCAACCACCACTGCTCTTAAGACAGGTGGACCATCCTGTGGCTGCATTGTTCAACCAT

TTGAACAG - UNI1099 - CCCTGCTTTAAGGCTGGTCAGTTCTTCAAGCAAGGGAAGAAGGCTTCAAGGCGACTGTCTCAAATCTCTGGAGATTG C

CCTGCTTTAAGGCTGGTCAGTTCTTCAAGCAAGGGAAGAAGGCTTCAAGGCGACTGTCTCAGATCTCTGGAGATTG TCCTGCTTTAAGGCTGGTCAGTT

CTTCAAGCAAGGGAAGAAGGCTTCAAGGCGACTGTCTCAGATCTTGGAG GACTCCCTGCAGTGAGTCAGCTGTTGGTCTTTAACACCACTTGAACGCAG

AGAAGAGGGGAGACCTGCACCACATCTGTGAAG GTCGCCTGCCGTGGCTGCTTGGTGGTGCTGAGGTTGCTGCTGACCAGTGCAATCATCAGGTCTGCA

CTCACCCAGGACCTGTCCATCGTCCTCCAGCTTGATTTCAGCTCTTCTGCAGTGTATCTGTGTTATTGACTGAGACTGCTTGGGTAGGAGCCTCACTGAG

TGCTGAATTGTCATTTCAGGCTAATTCTTTGTAATCTCATACCCTCACTTATCTAAGATCGTCGTGCAGAGCTATCCTGTAACAGATCTCTAGTGAAGGC

TCACTGTTGTTAAGTCATATACAGTAGACTTGATTGAACTTGTACTATGACTAGGGCAGAGGTTGAGCCTGGTGCCCAGGCAAAGGCTGAAAATAAGCCT

GGGGATGAGAATGCTAATGCTGCTGAAGTAGAGCCTGAAGCCCCATTGGTGGTCAGACCCAAGGTTAGGACACAAATCATGACTGGAGCAAGGCCCAAAG

TGAAGCCTAAGGGTACCCCTGGAGCAAGACCTAAAGGTGAAACCAGTACACCAGGTGGGGCATATGCCAAATGTAAACCTAAGGCAATCCCTATTGCTCG

ATCCAAGCATGATGCCCAAGTGTGGGCCCCAAATAAGTTTCGTGGCGAGTCCATGTCAAAGATGGGAAAGCAATGTCAGATCAGTGCTGCAGACCCTCCA

CTGCTCAGTAATGATTCTGGGATGGTTGCTCAAGCTAAGTGCCTGCCTGTAGATAGAGAACTTGCTAATATGGACACTGAGAGTATTCCCAAAAAGGCTA

ATTCTCCAGCTGGATTCCAGCCTTCCTATGGCTCAGAGGAGGGAACCAATATGGGGTCCTGGTACCGTGCCAGGCCTGTCCCCAAAGGAGAGGCCTATGA

GAATTCCGATTTCAAATGGGCAGATAAACCCTCAGGAAGTCCCTCCTTTTGGAATAGAGATGAAGCCAGTACAAGATTTCGTCCTAGGAAAAGCATGAAG

GCCAATAACAGGTTCAGGCATATGGCCAAACAAGAGGCAAATACCATGCCTAGGCACAAAAACAAACAAGAGTTCTATAATATTTCCAGTTCTGATTCTG

AGGATGAGTCTGGTAAAACTCCCTGGTTCTGGCCCAAAGACAAGACCAAAGTCTGGTCTAAGCCCAAAGAAGAGCCCAATAGTAGGTCCTGGTTTAGGTC

TAAGAAAGAAGTCCGTGTTGAATCCACTTCTGGGTCTGAATGTGAAAATCCTACAAAATCTTTGTTTTGGTCTGGAGAAGAGGCTAAATCTAGATCCAAA

CCCAGAGCCAGGAAAGGGGTCAATATGAGGGCCAGGCAGCAGGCCAAGCGAGAAGCTTGCAGTGATGCCATGTCTGGAGCTATAGATACAAATAAGAAAG

AGTCCTGGTTCTTGCCTGAAGAGAAAGCTAATGTTTTTTCAAAGTCTAAGACAAAGAAAGAGCCCAGAACCAGAGCAGTGCCAAAGGAAGAAGTCAAAAC

TAAGGCCAGAGCAAGTACCAAGCAAGAAGCCAGGCCAGAGGAGGAAGTCCTCGTTGGGGCTTGGTTCTGGGACACCCAGGAGTCCACTATGGCAGATAGG

ATAAGCATCAAGACCACTTTTGTAGAGGAGGAGCCCATTGTTGGAGATTGGTTCTGGAGTGAAGAAGAAGCCAGTGTGGACTCTGAGACCTGTCATACAT

CCAGACCCAGGGCTAAGGAGGAGCAAGTTAGTAGTTTCTGTTTAGGGTCTGGAAAGAAGAGCAGTATGGAAAGTGGGCCAAAGGCTACTTCTAAATCTAT

GCCAGTAGCTAAGGAGGATGAGGTCGTTATTGGGTCCTGGTTCTGGGCAGATGATGAAGAGATCAACTTACAGGCTGATGACGAGTCTATTTTTGGATCT

TGGTTCTGGGGCACTGGTGAGAACAGCCTTAGATCTGTTGGAGTCAATTGTGAGAAGATGCCGAAGGCTGGAGAAAAAGAAGTTACTGATTCCTGGTTCT

GGGCTGGAGATGTCAATACAGAGGCTGAGGTTGAAGAACAGGCCAGGTCGGCATCTACAAAAGCAACAATCTTTGTGCCTTGGTTTTGGTCTGAAAAGCA

GCCGAACATGGATTTAGGGTCTGAACCTTGCTCAGATATCATGGCAGGAGCTGAGGAGGAGCCCATAATTGGGCCCTGGTTCTGGGCTAAAGTAGATAAT

AGTGTGGAGGCTGAAGTTAACAGTAAGTCTAGCCTTGAGGATGAGGAAGAACCCATTAGATCCCCTTGGTTTGGGGCCAGAGAACAAACCGATATGAAGT

ATGCAGCTGGTATCAGATACAAGCCTATGGCAGAAGCTGAGGATGCTAACAAAAAGTCTTGTGTCTGGGCAAAAGAACCCTGTTTGTATCCTACCAATAG

AGAATGCTTGAAATCTACTCTGGGAGAAAAAGAAGACACTGTTGATCCATGGCTCTGGTCCAATAATTATCCAAGGACCAAGACCATCACAGGGTCCTGG

CTATGGGCTGCAGAAGAGGGAAATATAGATGATGAGACTGGAGAAAAGATTAAACTACCAACTTTAGAGGACAATGCATTCAATTCTTGGTTCTGGAAAG

AAAATGAAGAAAGCATTGTAGAGGCTCCCAAGAGAGAAGAATTCAGGCCAGAAGCGGAAGAGGAAGACATTATTGGTTCTTGGTTTTGGGCTGGGGATGA

AGACAGGTTTGAGCCAGCTGCTAAGATTAATGAAGAGAACAAGATAGCATCTGAAGATGAAGATACAGTTGGATCCTGGTTCTGGGGCAATGAAGAGGCC

AGTCTAGAGGCAGTGAGAAGGGGTACTTTTGAGTCTGCTCCTGGGATTAAGGAAGAGAAAGTTACTGGGTCATGGTTCTGGACTGATAAGGCCAAAGTAG

GGGCTGGGTCCCAGACTGTCGAAACTGGGTCAGAAACTGAAGAGGAAGCAATTTTTGAGTCCTTGATCTGGGCTGCAAAAAAGGACAGTATTCAAGCAGG

AGTAAAGCGTGTGTCCAAGCCAAAAGATGACGGTAACATAGCTGTTGGGTCCTGGCTCTGGTCTAGTGACAAGGCCACAAAAGAAGCTAAAACTCTGATT

GTCAGTGAGGCCAGTCCAGAAAATGGGAAAGAGTCAGTTGTTAAGTTTGGGTCAAGAGCAAAAGATGAGGTGATTAACAAGACTGGCAGTGGTGACAATT

GTAAACATAGTACAGAAGCTGAAACCATAGTGGGAGCCTGGTTCTGGGAAGGAGATGAAGCTAGCTTTGAATCAAATCCTGTACCTGTATGCAAGGCCGT

TTGTGAACCCGAGTCTTCAGCTGAGCACGAACCTGACCCTTCCCGCAGGCCTCAGAGCTGGGATGAGGTCACTGTTCAGTTTAAGGCTGGTCCGTGGGGA

AAAGCTGGCTTCCCACCCATGAACCCCTTCAGATTCCCCAAAGAAGCGGCATCTCTGTTTGCAGAAATGTTTGGGGGAAAGCCTAAGCTTGTGGAAGTTG

GTCCAGAAAGGGAGCCTGAACCCCAGTTCCCATTTCAGTATGATCCCTCTTACCGCTCAGTCCGAGAAATTCGCGAGCATCTTAAGGCCAGGGAAAGTGC

ACAGCCAGAGAATTGGTCTTGCAACTGCATCCAGTGTGAGCTTAGAATTGGTTCTGAGGAGTTTGAGGAGCTTCTTTTACTGATGGACAGAAATCGTGAT

CCTTTTATCCATGAGATATCTAAGATTGCAATGGGCATGCGAGGTGCTTCTCAGTTTACCCGGGATTTCATTCGAAACTCGGGCGTTGTCTCCCTGATTG

AAGCCTTACTTAACTATCCGTCCTCCCGAGTGAGGACAAGGTTTTTGGAAAATATGGTCCGCATGGCTCCCCCTTATCCAGACCTGAACATGATTGAGAC

ATACGTGTGTCAGATTTGCGAGGACACCTTTGACTATGACTTGGATTCCCCTGATCAGTTGTCCGGATTGACAATGATTACACACCTCACTGCTACTTCT

GACTATCACAAGGTGGTTGTCAATTACTTGGCTGGGTTTTTCTACTTACTGAATTCAGGCAATACCAAAACAAGGTTTCATGTTCTGAAACTGCTACTGA

ATTTGTCTGAAAACCTTGTCATGACAAAACGCCTACTTGTTACTGATTCGGTGTCAGAATTTATGGACCTTATTAATAGGGAGGAGTCAGATGAAAACAT

TCAAATTGTTCTTGCAATATTTGAGACTATCAGTAAACATATTCAAAAAGAGGCACTGTTTTCTGATGATGATGATGATGATGAAGAAGAAGATGCAGTG

AATCTTGAACCATTTATTTCTGCATTCCGTGAGGCTGAAAAAATTGCCAAGGAACTAAAACGCAAACCTGGCAATCAAAAAGCACCCTGAAGCAGTACAA

CAAAAACAAAAAGTAATTTGACTAACCCTTTGCCTCCGGTTGTCCTTTTGTTCCTGAGTCATCTGACCCTCAAATACTGCTTTGCTTTCCCAGCTGCTTC

CTTGTTTCAGTGTACCTCTCTAATGCTGGTGGCAATTCTACCCAACCCTGTGTACTCTGTATTATCGTTCTGATGCCAAATGAAGATACAACTGAAAACA

CATGACACTTGTTGATGACGCTTGTTGTGTTGATTGTGATGTTCAGTATTTGAGTGTAAAGTGAACTGAGCCGTTGTAAATAAGATGCCCTTCTAAATGT

TGTTCTCGTGTATATTTGAGTCTTGTGCTTCAATAAAGGTCTATGTGAAAGTGAGCAGAAA
Translation
     - UNI1099 -     MTRAEVEPGAQAKAENKPGDENANAAEVEPEAPLVVRPKVRTQIMTGARPKVKPKGTPGARPKGETSTPGGAYAKCKPK

AIPIARSKHDAQVWAPNKFRGESMSKMGKQCQISAADPPLLSNDSGMVAQAKCLPVDRELANMDTESIPKKANSPAGFQPSYGSEEGTNMGSWYRARPVP

KGEAYENSDFKWADKPSGSPSFWNRDEASTRFRPRKSMKANNRFRHMAKQEANTMPRHKNKQEFYNISSSDSEDESGKTPWFWPKDKTKVWSKPKEEPNS

RSWFRSKKEVRVESTSGSECENPTKSLFWSGEEAKSRSKPRARKGVNMRARQQAKREACSDAMSGAIDTNKKESWFLPEEKANVFSKSKTKKEPRTRAVP

KEEVKTKARASTKQEARPEEEVLVGAWFWDTQESTMADRISIKTTFVEEEPIVGDWFWSEEEASVDSETCHTSRPRAKEEQVSSFCLGSGKKSSMESGPK

ATSKSMPVAKEDEVVIGSWFWADDEEINLQADDESIFGSWFWGTGENSLRSVGVNCEKMPKAGEKEVTDSWFWAGDVNTEAEVEEQARSASTKATIFVPW

FWSEKQPNMDLGSEPCSDIMAGAEEEPIIGPWFWAKVDNSVEAEVNSKSSLEDEEEPIRSPWFGAREQTDMKYAAGIRYKPMAEAEDANKKSCVWAKEPC

LYPTNRECLKSTLGEKEDTVDPWLWSNNYPRTKTITGSWLWAAEEGNIDDETGEKIKLPTLEDNAFNSWFWKENEESIVEAPKREEFRPEAEEEDIIGSW

FWAGDEDRFEPAAKINEENKIASEDEDTVGSWFWGNEEASLEAVRRGTFESAPGIKEEKVTGSWFWTDKAKVGAGSQTVETGSETEEEAIFESLIWAAKK

DSIQAGVKRVSKPKDDGNIAVGSWLWSSDKATKEAKTLIVSEASPENGKESVVKFGSRAKDEVINKTGSGDNCKHSTEAETIVGAWFWEGDEASFESNPV

PVCKAVCEPESSAEHEPDPSRRPQSWDEVTVQFKAGPWGKAGFPPMNPFRFPKEAASLFAEMFGGKPKLVEVGPEREPEPQFPFQYDPSYRSVREIREHL

KARESAQPENWSCNCIQCELRIGSEEFEELLLLMDRNRDPFIHEISKIAMGMRGASQFTRDFIRNSGVVSLIEALLNYPSSRVRTRFLENMVRMAPPYPD

LNMIETYVCQICEDTFDYDLDSPDQLSGLTMITHLTATSDYHKVVVNYLAGFFYLLNSGNTKTRFHVLKLLLNLSENLVMTKRLLVTDSVSEFMDLINRE

ESDENIQIVLAIFETISKHIQKEALFSDDDDDDEEEDAVNLEPFISAFREAEKIAKELKRKPGNQKAP
Transcript ENSMUST00000113144
Sequence
GTAGTCGCTTCGTGAGGGACCGGAGAGAGGAGTGGGTACCGAAAGGTGACAGTAATTTGCTAGTCATGGCCCTTCATCTTGTCCTACATCCCAAGCTCCC

GGCAAGCCCCTAAATTACAGTCGCCGCCATTGCCTCTGCTCCCTGCGGCGGACTGCCGACGGCGTTTGCCTGCCTCCTTTCTGTGTGGGAAGGCGCCGCC

GGAGAGAACGCACCTAAGAAAACTGCCTTGGATTCAAGCAGAACAG GTTTGCCAGATCTGCTGCAGGGCTTGTCGCCAGTGGAAACAGAGAAAGGAGGA

AACAATCCCTTGGCAAGAGCGCAG ATCTCCCCTAGCCTAGAATACCAGCTGTGAGCACTTCTCTCAGTGGAGATCTTCATAGTGCAATCGGACCAAATC

CTCTGGAAACATTCTGTATCTCAAATGCCCCGTGGAGTACACTCTTACCCAG ACCAACAGCAACCACCACTGCTCTTAAGACAGGTGGACCATCCTGTG

GCTGCATTGTTCAACCATTTGAACAG - UNI1099 - GCGAGCTGGCTTGCCGCAGTCTACGCAGCCCCTGCCTGTTTGGTGCAGAGGCGTGGGGACA

GGACACATCTCTGCCATTCCACTCGCGCGCAAAGCGTTAAAGACCAGTGAGAGGATCCGCCGAGGACAGAGAACACCCAGGAATAGGAGTCGGACGTGGG

GGAGCCCAGGGACCTGGGCCGTGCGCCTGGCCAG GTCTGGCATATTCTGGCAAGCCACGGTGAGCATCTATAGACCAGAAGCTTGAGAAAAGAGGAACA

GGAAAATGGCGTGGATTTCTGGAG CCCTGCTTTAAGGCTGGTCAGTTCTTCAAGCAAGGGAAGAAGGCTTCAAGGCGACTGTCTCAAATCTCTGGAGAT

TG CCCTGCTTTAAGGCTGGTCAGTTCTTCAAGCAAGGGAAGAAGGCTTCAAGGCGACTGTCTCAGATCTCTGGAGATTG TCCTGCTTTAAGGCTGGTC

AGTTCTTCAAGCAAGGGAAGAAGGCTTCAAGGCGACTGTCTCAGATCTTGGAG GACTCCCTGCAGTGAGTCAGCTGTTGGTCTTTAACACCACTTGAAC

GCAGAGAAGAGGGGAGACCTGCACCACATCTGTGAAG GTCGCCTGCCGTGGCTGCTTGGTGGTGCTGAGGTTGCTGCTGACCAGTGCAATCATCAGGTC

TGCACTCACCCAGGACCTGTCCATCGTCCTCCAGCTTGATTTCAGCTCTTCTGCAGTGTATCTGTGTTATTGACTGAGACTGCTTGGGTAGGAGCCTCAC

TGAGTGCTGAATTGTCATTTCAGGCTAATTCTTTGTAATCTCATACCCTCACTTATCTAAGATCGTCGTGCAGAGCTATCCTGTAACAGATCTCTAGTGA

AGGCTCACTGTTGTTAAGTCATATACAGTAGACTTGATTGAACTTGTACTATGACTAGGGCAGAGGTTGAGCCTGGTGCCCAGGCAAAGGCTGAAAATAA

GCCTGGGGATGAGAATGCTAATGCTGCTGAAGTAGAGCCTGAAGCCCCATTGGTGGTCAGACCCAAGGTTAGGACACAAATCATGACTGGAGCAAGGCCC

AAAGTGAAGCCTAAGGGTACCCCTGGAGCAAGACCTAAAGGTGAAACCAGTACACCAGGTGGGGCATATGCCAAATGTAAACCTAAGGCAATCCCTATTG

CTCGATCCAAGCATGATGCCCAAGTGTGGGCCCCAAATAAGTTTCGTGGCGAGTCCATGTCAAAGATGGGAAAGCAATGTCAGATCAGTGCTGCAGACCC

TCCACTGCTCAGTAATGATTCTGGGATGGTTGCTCAAGCTAAGTGCCTGCCTGTAGATAGAGAACTTGCTAATATGGACACTGAGAGTATTCCCAAAAAG

GCTAATTCTCCAGCTGGATTCCAGCCTTCCTATGGCTCAGAGGAGGGAACCAATATGGGGTCCTGGTACCGTGCCAGGCCTGTCCCCAAAGGAGAGGCCT

ATGAGAATTCCGATTTCAAATGGGCAGATAAACCCTCAGGAAGTCCCTCCTTTTGGAATAGAGATGAAGCCAGTACAAGATTTCGTCCTAGGAAAAGCAT

GAAGGCCAATAACAGGTTCAGGCATATGGCCAAACAAGAGGCAAATACCATGCCTAGGCACAAAAACAAACAAGAGTTCTATAATATTTCCAGTTCTGAT

TCTGAGGATGAGTCTGGTAAAACTCCCTGGTTCTGGCCCAAAGACAAGACCAAAGTCTGGTCTAAGCCCAAAGAAGAGCCCAATAGTAGGTCCTGGTTTA

GGTCTAAGAAAGAAGTCCGTGTTGAATCCACTTCTGGGTCTGAATGTGAAAATCCTACAAAATCTTTGTTTTGGTCTGGAGAAGAGGCTAAATCTAGATC

CAAACCCAGAGCCAGGAAAGGGGTCAATATGAGGGCCAGGCAGCAGGCCAAGCGAGAAGCTTGCAGTGATGCCATGTCTGGAGCTATAGATACAAATAAG

AAAGAGTCCTGGTTCTTGCCTGAAGAGAAAGCTAATGTTTTTTCAAAGTCTAAGACAAAGAAAGAGCCCAGAACCAGAGCAGTGCCAAAGGAAGAAGTCA

AAACTAAGGCCAGAGCAAGTACCAAGCAAGAAGCCAGGCCAGAGGAGGAAGTCCTCGTTGGGGCTTGGTTCTGGGACACCCAGGAGTCCACTATGGCAGA

TAGGATAAGCATCAAGACCACTTTTGTAGAGGAGGAGCCCATTGTTGGAGATTGGTTCTGGAGTGAAGAAGAAGCCAGTGTGGACTCTGAGACCTGTCAT

ACATCCAGACCCAGGGCTAAGGAGGAGCAAGTTAGTAGTTTCTGTTTAGGGTCTGGAAAGAAGAGCAGTATGGAAAGTGGGCCAAAGGCTACTTCTAAAT

CTATGCCAGTAGCTAAGGAGGATGAGGTCGTTATTGGGTCCTGGTTCTGGGCAGATGATGAAGAGATCAACTTACAGGCTGATGACGAGTCTATTTTTGG

ATCTTGGTTCTGGGGCACTGGTGAGAACAGCCTTAGATCTGTTGGAGTCAATTGTGAGAAGATGCCGAAGGCTGGAGAAAAAGAAGTTACTGATTCCTGG

TTCTGGGCTGGAGATGTCAATACAGAGGCTGAGGTTGAAGAACAGGCCAGGTCGGCATCTACAAAAGCAACAATCTTTGTGCCTTGGTTTTGGTCTGAAA

AGCAGCCGAACATGGATTTAGGGTCTGAACCTTGCTCAGATATCATGGCAGGAGCTGAGGAGGAGCCCATAATTGGGCCCTGGTTCTGGGCTAAAGTAGA

TAATAGTGTGGAGGCTGAAGTTAACAGTAAGTCTAGCCTTGAGGATGAGGAAGAACCCATTAGATCCCCTTGGTTTGGGGCCAGAGAACAAACCGATATG

AAGTATGCAGCTGGTATCAGATACAAGCCTATGGCAGAAGCTGAGGATGCTAACAAAAAGTCTTGTGTCTGGGCAAAAGAACCCTGTTTGTATCCTACCA

ATAGAGAATGCTTGAAATCTACTCTGGGAGAAAAAGAAGACACTGTTGATCCATGGCTCTGGTCCAATAATTATCCAAGGACCAAGACCATCACAGGGTC

CTGGCTATGGGCTGCAGAAGAGGGAAATATAGATGATGAGACTGGAGAAAAGATTAAACTACCAACTTTAGAGGACAATGCATTCAATTCTTGGTTCTGG

AAAGAAAATGAAGAAAGCATTGTAGAGGCTCCCAAGAGAGAAGAATTCAGGCCAGAAGCGGAAGAGGAAGACATTATTGGTTCTTGGTTTTGGGCTGGGG

ATGAAGACAGGTTTGAGCCAGCTGCTAAGATTAATGAAGAGAACAAGATAGCATCTGAAGATGAAGATACAGTTGGATCCTGGTTCTGGGGCAATGAAGA

GGCCAGTCTAGAGGCAGTGAGAAGGGGTACTTTTGAGTCTGCTCCTGGGATTAAGGAAGAGAAAGTTACTGGGTCATGGTTCTGGACTGATAAGGCCAAA

GTAGGGGCTGGGTCCCAGACTGTCGAAACTGGGTCAGAAACTGAAGAGGAAGCAATTTTTGAGTCCTTGATCTGGGCTGCAAAAAAGGACAGTATTCAAG

CAGGAGTAAAGCGTGTGTCCAAGCCAAAAGATGACGGTAACATAGCTGTTGGGTCCTGGCTCTGGTCTAGTGACAAGGCCACAAAAGAAGCTAAAACTCT

GATTGTCAGTGAGGCCAGTCCAGAAAATGGGAAAGAGTCAGTTGTTAAGTTTGGGTCAAGAGCAAAAGATGAGGTGATTAACAAGACTGGCAGTGGTGAC

AATTGTAAACATAGTACAGAAGCTGAAACCATAGTGGGAGCCTGGTTCTGGGAAGGAGATGAAGCTAGCTTTGAATCAAATCCTGTACCTGTATGCAAGG

CCGTTTGTGAACCCGAGTCTTCAGCTGAGCACGAACCTGACCCTTCCCGCAGGCCTCAGAGCTGGGATGAGGTCACTGTTCAGTTTAAGGCTGGTCCGTG

GGGAAAAGCTGGCTTCCCACCCATGAACCCCTTCAGATTCCCCAAAGAAGCGGCATCTCTGTTTGCAGAAATGTTTGGGGGAAAGCCTAAGCTTGTGGAA

GTTGGTCCAGAAAGGGAGCCTGAACCCCAGTTCCCATTTCAGTATGATCCCTCTTACCGCTCAGTCCGAGAAATTCGCGAGCATCTTAAGGCCAGGGAAA

GTGCACAGCCAGAGAATTGGTCTTGCAACTGCATCCAGTGTGAGCTTAGAATTGGTTCTGAGGAGTTTGAGGAGCTTCTTTTACTGATGGACAGAAATCG

TGATCCTTTTATCCATGAGATATCTAAGATTGCAATGGGCATGCGAGGTGCTTCTCAGTTTACCCGGGATTTCATTCGAAACTCGGGCGTTGTCTCCCTG

ATTGAAGCCTTACTTAACTATCCGTCCTCCCGAGTGAGGACAAGGTTTTTGGAAAATATGGTCCGCATGGCTCCCCCTTATCCAGACCTGAACATGATTG

AGACATACGTGTGTCAGATTTGCGAGGACACCTTTGACTATGACTTGGATTCCCCTGATCAGTTGTCCGGATTGACAATGATTACACACCTCACTGCTAC

TTCTGACTATCACAAGGTGGTTGTCAATTACTTGGCTGGGTTTTTCTACTTACTGAATTCAGGCAATACCAAAACAAGGTTTCATGTTCTGAAACTGCTA

CTGAATTTGTCTGAAAACCTTGTCATGACAAAACGCCTACTTGTTACTGATTCGGTGTCAGAATTTATGGACCTTATTAATAGGGAGGAGTCAGATGAAA

ACATTCAAATTGTTCTTGCAATATTTGAGACTATCAGTAAACATATTCAAAAAGAGGCACTGTTTTCTGATGATGATGATGATGATGAAGAAGAAGATGC

AGTGAATCTTGAACCATTTATTTCTGCATTCCGTGAGGCTGAAAAAATTGCCAAGGAACTAAAACGCAAACCTGGCAATCAAAAAGCACCCTGAAGCAGT

ACAACAAAAACAAAAAGTAATTTGACTAACCCTTTGCCTCCGGTTGTCCTTTTGTTCCTGAGTCATCTGACCCTCAAATACTGCTTTGCTTTCCCAGCTG

CTTCCTTGTTTCAGTGTACCTCTCTAATGCTGGTGGCAATTCTACCCAACCCTGTGTACTCTGTATTATCGTTCTGATGCCAAATGAAGATACAACTGAA

AACACATGACACTTGTTGATGACGCTTGTTGTGTTGATTGTGATGTTCAGTATTTGAGTGTAAAGTGAACTGAGCCGTTGTAAATAAGATGCCCTTCTAA

ATGTTGTTCTCGTGTATATTTGAGTCTTGTGCTTCAATAAAGGTCTATGTGAAAGTGAGCAGAAA
Translation
    - UNI1099 -       MTRAEVEPGAQAKAENKPGDENANAAEVEPEAPLVVRPKVRTQIMTGARPKVKPKGTPGARPKGETSTPGGAYAKCKP

KAIPIARSKHDAQVWAPNKFRGESMSKMGKQCQISAADPPLLSNDSGMVAQAKCLPVDRELANMDTESIPKKANSPAGFQPSYGSEEGTNMGSWYRARPV

PKGEAYENSDFKWADKPSGSPSFWNRDEASTRFRPRKSMKANNRFRHMAKQEANTMPRHKNKQEFYNISSSDSEDESGKTPWFWPKDKTKVWSKPKEEPN

SRSWFRSKKEVRVESTSGSECENPTKSLFWSGEEAKSRSKPRARKGVNMRARQQAKREACSDAMSGAIDTNKKESWFLPEEKANVFSKSKTKKEPRTRAV

PKEEVKTKARASTKQEARPEEEVLVGAWFWDTQESTMADRISIKTTFVEEEPIVGDWFWSEEEASVDSETCHTSRPRAKEEQVSSFCLGSGKKSSMESGP

KATSKSMPVAKEDEVVIGSWFWADDEEINLQADDESIFGSWFWGTGENSLRSVGVNCEKMPKAGEKEVTDSWFWAGDVNTEAEVEEQARSASTKATIFVP

WFWSEKQPNMDLGSEPCSDIMAGAEEEPIIGPWFWAKVDNSVEAEVNSKSSLEDEEEPIRSPWFGAREQTDMKYAAGIRYKPMAEAEDANKKSCVWAKEP

CLYPTNRECLKSTLGEKEDTVDPWLWSNNYPRTKTITGSWLWAAEEGNIDDETGEKIKLPTLEDNAFNSWFWKENEESIVEAPKREEFRPEAEEEDIIGS

WFWAGDEDRFEPAAKINEENKIASEDEDTVGSWFWGNEEASLEAVRRGTFESAPGIKEEKVTGSWFWTDKAKVGAGSQTVETGSETEEEAIFESLIWAAK

KDSIQAGVKRVSKPKDDGNIAVGSWLWSSDKATKEAKTLIVSEASPENGKESVVKFGSRAKDEVINKTGSGDNCKHSTEAETIVGAWFWEGDEASFESNP

VPVCKAVCEPESSAEHEPDPSRRPQSWDEVTVQFKAGPWGKAGFPPMNPFRFPKEAASLFAEMFGGKPKLVEVGPEREPEPQFPFQYDPSYRSVREIREH

LKARESAQPENWSCNCIQCELRIGSEEFEELLLLMDRNRDPFIHEISKIAMGMRGASQFTRDFIRNSGVVSLIEALLNYPSSRVRTRFLENMVRMAPPYP

DLNMIETYVCQICEDTFDYDLDSPDQLSGLTMITHLTATSDYHKVVVNYLAGFFYLLNSGNTKTRFHVLKLLLNLSENLVMTKRLLVTDSVSEFMDLINR

EESDENIQIVLAIFETISKHIQKEALFSDDDDDDEEEDAVNLEPFISAFREAEKIAKELKRKPGNQKAP
Transcript ENSMUST00000057164
Sequence
CAGGCGAGCTGGCTTGCCGCAGTCTACGCAGCCCCTGCCTGTTTGGTGCAGAGGCGTGGGGACAGGACACATCTCTGCCATTCCACTCGCGCGCAAAGCG

TTAAAGACCAGTGAGAGGATCCGCCGAGGACAGAGAACACCCAGGAATAGGAGTCGGACGTGGGGGAGCCCAGGGACCTGGGCCGTGCGCCTGGCCAG C

CCTGCTTTAAGGCTGGTCAGTTCTTCAAGCAAGGGAAGAAGGCTTCAAGGCGACTGTCTCAAATCTCTGGAGATTG CCCTGCTTTAAGGCTGGTCAGTT

CTTCAAGCAAGGGAAGAAGGCTTCAAGGCGACTGTCTCAGATCTCTGGAGATTG TCCTGCTTTAAGGCTGGTCAGTTCTTCAAGCAAGGGAAGAAGGCT

TCAAGGCGACTGTCTCAGATCTTGGAG GACTCCCTGCAGTGAGTCAGCTGTTGGTCTTTAACACCACTTGAACGCAGAGAAGAGGGGAGACCTGCACCA

CATCTGTGAAG GTCGCCTGCCGTGGCTGCTTGGTGGTGCTGAGGTTGCTGCTGACCAGTGCAATCATCAGGTCTGCACTCACCCAGGACCTGTCCATCG

TCCTCCAGCTTGATTTCAGCTCTTCTGCAGTGTATCTGTGTTATTGACTGAGACTGCTTGGGTAGGAGCCTCACTGAGTGCTGAATTGTCATTTCAGGCT

AATTCTTTGTAATCTCATACCCTCACTTATCTAAGATCGTCGTGCAGAGCTATCCTGTAACAGATCTCTAGTGAAGGCTCACTGTTGTTAAGTCATATAC

AGTAGACTTGATTGAACTTGTACTATGACTAGGGCAGAGGTTGAGCCTGGTGCCCAGGCAAAGGCTGAAAATAAGCCTGGGGATGAGAATGCTAATGCTG

CTGAAGTAGAGCCTGAAGCCCCATTGGTGGTCAGACCCAAGGTTAGGACACAAATCATGACTGGAGCAAGGCCCAAAGTGAAGCCTAAGGGTACCCCTGG

AGCAAGACCTAAAGGTGAAACCAGTACACCAGGTGGGGCATATGCCAAATGTAAACCTAAGGCAATCCCTATTGCTCGATCCAAGCATGATGCCCAAGTG

TGGGCCCCAAATAAGTTTCGTGGCGAGTCCATGTCAAAGATGGGAAAGCAATGTCAGATCAGTGCTGCAGACCCTCCACTGCTCAGTAATGATTCTGGGA

TGGTTGCTCAAGCTAAGTGCCTGCCTGTAGATAGAGAACTTGCTAATATGGACACTGAGAGTATTCCCAAAAAGGCTAATTCTCCAGCTGGATTCCAGCC

TTCCTATGGCTCAGAGGAGGGAACCAATATGGGGTCCTGGTACCGTGCCAGGCCTGTCCCCAAAGGAGAGGCCTATGAGAATTCCGATTTCAAATGGGCA

GATAAACCCTCAGGAAGTCCCTCCTTTTGGAATAGAGATGAAGCCAGTACAAGATTTCGTCCTAGGAAAAGCATGAAGGCCAATAACAGGTTCAGGCATA

TGGCCAAACAAGAGGCAAATACCATGCCTAGGCACAAAAACAAACAAGAGTTCTATAATATTTCCAGTTCTGATTCTGAGGATGAGTCTGGTAAAACTCC

CTGGTTCTGGCCCAAAGACAAGACCAAAGTCTGGTCTAAGCCCAAAGAAGAGCCCAATAGTAGGTCCTGGTTTAGGTCTAAGAAAGAAGTCCGTGTTGAA

TCCACTTCTGGGTCTGAATGTGAAAATCCTACAAAATCTTTGTTTTGGTCTGGAGAAGAGGCTAAATCTAGATCCAAACCCAGAGCCAGGAAAGGGGTCA

ATATGAGGGCCAGGCAGCAGGCCAAGCGAGAAGCTTGCAGTGATGCCATGTCTGGAGCTATAGATACAAATAAGAAAGAGTCCTGGTTCTTGCCTGAAGA

GAAAGCTAATGTTTTTTCAAAGTCTAAGACAAAGAAAGAGCCCAGAACCAGAGCAGTGCCAAAGGAAGAAGTCAAAACTAAGGCCAGAGCAAGTACCAAG

CAAGAAGCCAGGCCAGAGGAGGAAGTCCTCGTTGGGGCTTGGTTCTGGGACACCCAGGAGTCCACTATGGCAGATAGGATAAGCATCAAGACCACTTTTG

TAGAGGAGGAGCCCATTGTTGGAGATTGGTTCTGGAGTGAAGAAGAAGCCAGTGTGGACTCTGAGACCTGTCATACATCCAGACCCAGGGCTAAGGAGGA

GCAAGTTAGTAGTTTCTGTTTAGGGTCTGGAAAGAAGAGCAGTATGGAAAGTGGGCCAAAGGCTACTTCTAAATCTATGCCAGTAGCTAAGGAGGATGAG

GTCGTTATTGGGTCCTGGTTCTGGGCAGATGATGAAGAGATCAACTTACAGGCTGATGACGAGTCTATTTTTGGATCTTGGTTCTGGGGCACTGGTGAGA

ACAGCCTTAGATCTGTTGGAGTCAATTGTGAGAAGATGCCGAAGGCTGGAGAAAAAGAAGTTACTGATTCCTGGTTCTGGGCTGGAGATGTCAATACAGA

GGCTGAGGTTGAAGAACAGGCCAGGTCGGCATCTACAAAAGCAACAATCTTTGTGCCTTGGTTTTGGTCTGAAAAGCAGCCGAACATGGATTTAGGGTCT

GAACCTTGCTCAGATATCATGGCAGGAGCTGAGGAGGAGCCCATAATTGGGCCCTGGTTCTGGGCTAAAGTAGATAATAGTGTGGAGGCTGAAGTTAACA

GTAAGTCTAGCCTTGAGGATGAGGAAGAACCCATTAGATCCCCTTGGTTTGGGGCCAGAGAACAAACCGATATGAAGTATGCAGCTGGTATCAGATACAA

GCCTATGGCAGAAGCTGAGGATGCTAACAAAAAGTCTTGTGTCTGGGCAAAAGAACCCTGTTTGTATCCTACCAATAGAGAATGCTTGAAATCTACTCTG

GGAGAAAAAGAAGACACTGTTGATCCATGGCTCTGGTCCAATAATTATCCAAGGACCAAGACCATCACAGGGTCCTGGCTATGGGCTGCAGAAGAGGGAA

ATATAGATGATGAGACTGGAGAAAAGATTAAACTACCAACTTTAGAGGACAATGCATTCAATTCTTGGTTCTGGAAAGAAAATGAAGAAAGCATTGTAGA

GGCTCCCAAGAGAGAAGAATTCAGGCCAGAAGCGGAAGAGGAAGACATTATTGGTTCTTGGTTTTGGGCTGGGGATGAAGACAGGTTTGAGCCAGCTGCT

AAGATTAATGAAGAGAACAAGATAGCATCTGAAGATGAAGATACAGTTGGATCCTGGTTCTGGGGCAATGAAGAGGCCAGTCTAGAGGCAGTGAGAAGGG

GTACTTTTGAGTCTGCTCCTGGGATTAAGGAAGAGAAAGTTACTGGGTCATGGTTCTGGACTGATAAGGCCAAAGTAGGGGCTGGGTCCCAGACTGTCGA

AACTGGGTCAGAAACTGAAGAGGAAGCAATTTTTGAGTCCTTGATCTGGGCTGCAAAAAAGGACAGTATTCAAGCAGGAGTAAAGCGTGTGTCCAAGCCA

AAAGATGACGGTAACATAGCTGTTGGGTCCTGGCTCTGGTCTAGTGACAAGGCCACAAAAGAAGCTAAAACTCTGATTGTCAGTGAGGCCAGTCCAGAAA

ATGGGAAAGAGTCAGTTGTTAAGTTTGGGTCAAGAGCAAAAGATGAGGTGATTAACAAGACTGGCAGTGGTGACAATTGTAAACATAGTACAGAAGCTGA

AACCATAGTGGGAGCCTGGTTCTGGGAAGGAGATGAAGCTAGCTTTGAATCAAATCCTGTACCTGTATGCAAGGCCGTTTGTGAACCCGAGTCTTCAGCT

GAGCACGAACCTGACCCTTCCCGCAGGCCTCAGAGCTGGGATGAGGTCACTGTTCAGTTTAAGGCTGGTCCGTGGGGAAAAGCTGGCTTCCCACCCATGA

ACCCCTTCAGATTCCCCAAAGAAGCGGCATCTCTGTTTGCAGAAATGTTTGGGGGAAAGCCTAAGCTTGTGGAAGTTGGTCCAGAAAGGGAGCCTGAACC

CCAGTTCCCATTTCAGTATGATCCCTCTTACCGCTCAGTCCGAGAAATTCGCGAGCATCTTAAGGCCAGGGAAAGTGCACAGCCAGAGAATTGGTCTTGC

AACTGCATCCAGTGTGAGCTTAGAATTGGTTCTGAGGAGTTTGAGGAGCTTCTTTTACTGATGGACAGAAATCGTGATCCTTTTATCCATGAGATATCTA

AGATTGCAATGGGCATGCGAGGTGCTTCTCAGTTTACCCGGGATTTCATTCGAAACTCGGGCGTTGTCTCCCTGATTGAAGCCTTACTTAACTATCCGTC

CTCCCGAGTGAGGACAAGGTTTTTGGAAAATATGGTCCGCATGGCTCCCCCTTATCCAGACCTGAACATGATTGAGACATACGTGTGTCAGATTTGCGAG

GACACCTTTGACTATGACTTGGATTCCCCTGATCAGTTGTCCGGATTGACAATGATTACACACCTCACTGCTACTTCTGACTATCACAAGGTGGTTGTCA

ATTACTTGGCTGGGTTTTTCTACTTACTGAATTCAGGCAATACCAAAACAAGGTTTCATGTTCTGAAACTGCTACTGAATTTGTCTGAAAACCTTGTCAT

GACAAAACGCCTACTTGTTACTGATTCGGTGTCAGAATTTATGGACCTTATTAATAGGGAGGAGTCAGATGAAAACATTCAAATTGTTCTTGCAATATTT

GAGACTATCAGTAAACATATTCAAAAAGAGGCACTGTTTTCTGATGATGATGATGATGATGAAGAAGAAGATGCAGTGAATCTTGAACCATTTATTTCTG

CATTCCGTGAGGCTGAAAAAATTGCCAAGGAACTAAAACGCAAACCTGGCAATCAAAAAGCACCCTGAAGCAGTACAACAAAAACAAAAAGTAATTTGAC

TAACCCTTTGCCTCCGGTTGTCCTTTTGTTCCTGAGTCATCTGACCCTCAAATACTGCTTTGCTTTCCCAGCTGCTTCCTTGTTTCAGTGTACCTCTCTA

ATGCTGGTGGCAATTCTACCCAACCCTGTGTACTCTGTATTATCGTTCTGATGCCAAATGAAGATACAACTGAAAACACATGACACTTGTTGATGACGCT

TGTTGTGTTGATTGTGATGTTCAGTATTTGAGTGTAAAGTGAACTGAGCCGTTGTAAATAAGATGCCCTTCTAAATGTTGTTCTCGTGTATATTTGAGTC

TTGTGCTTCAATAAAGGTCTATGTGAAAGTG
Translation
     MTRAEVEPGAQAKAENKPGDENANAAEVEPEAPLVVRPKVRTQIMTGARPKVKPKGTPGARPKGETSTPGGAYAKCKPKAIPIARSKHDAQVWAP

NKFRGESMSKMGKQCQISAADPPLLSNDSGMVAQAKCLPVDRELANMDTESIPKKANSPAGFQPSYGSEEGTNMGSWYRARPVPKGEAYENSDFKWADKP

SGSPSFWNRDEASTRFRPRKSMKANNRFRHMAKQEANTMPRHKNKQEFYNISSSDSEDESGKTPWFWPKDKTKVWSKPKEEPNSRSWFRSKKEVRVESTS

GSECENPTKSLFWSGEEAKSRSKPRARKGVNMRARQQAKREACSDAMSGAIDTNKKESWFLPEEKANVFSKSKTKKEPRTRAVPKEEVKTKARASTKQEA

RPEEEVLVGAWFWDTQESTMADRISIKTTFVEEEPIVGDWFWSEEEASVDSETCHTSRPRAKEEQVSSFCLGSGKKSSMESGPKATSKSMPVAKEDEVVI

GSWFWADDEEINLQADDESIFGSWFWGTGENSLRSVGVNCEKMPKAGEKEVTDSWFWAGDVNTEAEVEEQARSASTKATIFVPWFWSEKQPNMDLGSEPC

SDIMAGAEEEPIIGPWFWAKVDNSVEAEVNSKSSLEDEEEPIRSPWFGAREQTDMKYAAGIRYKPMAEAEDANKKSCVWAKEPCLYPTNRECLKSTLGEK

EDTVDPWLWSNNYPRTKTITGSWLWAAEEGNIDDETGEKIKLPTLEDNAFNSWFWKENEESIVEAPKREEFRPEAEEEDIIGSWFWAGDEDRFEPAAKIN

EENKIASEDEDTVGSWFWGNEEASLEAVRRGTFESAPGIKEEKVTGSWFWTDKAKVGAGSQTVETGSETEEEAIFESLIWAAKKDSIQAGVKRVSKPKDD

GNIAVGSWLWSSDKATKEAKTLIVSEASPENGKESVVKFGSRAKDEVINKTGSGDNCKHSTEAETIVGAWFWEGDEASFESNPVPVCKAVCEPESSAEHE

PDPSRRPQSWDEVTVQFKAGPWGKAGFPPMNPFRFPKEAASLFAEMFGGKPKLVEVGPEREPEPQFPFQYDPSYRSVREIREHLKARESAQPENWSCNCI

QCELRIGSEEFEELLLLMDRNRDPFIHEISKIAMGMRGASQFTRDFIRNSGVVSLIEALLNYPSSRVRTRFLENMVRMAPPYPDLNMIETYVCQICEDTF

DYDLDSPDQLSGLTMITHLTATSDYHKVVVNYLAGFFYLLNSGNTKTRFHVLKLLLNLSENLVMTKRLLVTDSVSEFMDLINREESDENIQIVLAIFETI

SKHIQKEALFSDDDDDDEEEDAVNLEPFISAFREAEKIAKELKRKPGNQKAP
Transcript ENSMUST00000070053
Sequence
CAGGCGAGCTGGCTTGCCGCAGTCTACGCAGCCCCTGCCTGTTTGGTGCAGAGGCGTGGGGACAGGACACATCTCTGCCATTCCACTCGCGCGCAAAGCG

TTAAAGACCAGTGAGAGGATCCGCCGAGGACAGAGAACACCCAGGAATAGGAGTCGGACGTGGGGGAGCCCAGGGACCTGGGCCGTGCGCCTGGCCAG G

TCTGGCATATTCTGGCAAGCCACGGTGAGCATCTATAGACCAGAAGCTTGAGAAAAGAGGAACAGGAAAATGGCGTGGATTTCTGGAG CCCTGCTTTAA

GGCTGGTCAGTTCTTCAAGCAAGGGAAGAAGGCTTCAAGGCGACTGTCTCAAATCTCTGGAGATTG CCCTGCTTTAAGGCTGGTCAGTTCTTCAAGCAA

GGGAAGAAGGCTTCAAGGCGACTGTCTCAGATCTCTGGAGATTG TCCTGCTTTAAGGCTGGTCAGTTCTTCAAGCAAGGGAAGAAGGCTTCAAGGCGAC

TGTCTCAGATCTTGGAG GACTCCCTGCAGTGAGTCAGCTGTTGGTCTTTAACACCACTTGAACGCAGAGAAGAGGGGAGACCTGCACCACATCTGTGAA

G GTCGCCTGCCGTGGCTGCTTGGTGGTGCTGAGGTTGCTGCTGACCAGTGCAATCATCAGGTCTGCACTCACCCAGGACCTGTCCATCGTCCTCCAGCT

TGATTTCAGCTCTTCTGCAGTGTATCTGTGTTATTGACTGAGACTGCTTGGGTAGGAGCCTCACTGAGTGCTGAATTGTCATTTCAGGCTAATTCTTTGT

AATCTCATACCCTCACTTATCTAAGATCGTCGTGCAGAGCTATCCTGTAACAGATCTCTAGTGAAGGCTCACTGTTGTTAAGTCATATACAGTAGACTTG

ATTGAACTTGTACTATGACTAGGGCAGAGGTTGAGCCTGGTGCCCAGGCAAAGGCTGAAAATAAGCCTGGGGATGAGAATGCTAATGCTGCTGAAGTAGA

GCCTGAAGCCCCATTGGTGGTCAGACCCAAGGTTAGGACACAAATCATGACTGGAGCAAGGCCCAAAGTGAAGCCTAAGGGTACCCCTGGAGCAAGACCT

AAAGGTGAAACCAGTACACCAGGTGGGGCATATGCCAAATGTAAACCTAAGGCAATCCCTATTGCTCGATCCAAGCATGATGCCCAAGTGTGGGCCCCAA

ATAAGTTTCGTGGCGAGTCCATGTCAAAGATGGGAAAGCAATGTCAGATCAGTGCTGCAGACCCTCCACTGCTCAGTAATGATTCTGGGATGGTTGCTCA

AGCTAAGTGCCTGCCTGTAGATAGAGAACTTGCTAATATGGACACTGAGAGTATTCCCAAAAAGGCTAATTCTCCAGCTGGATTCCAGCCTTCCTATGGC

TCAGAGGAGGGAACCAATATGGGGTCCTGGTACCGTGCCAGGCCTGTCCCCAAAGGAGAGGCCTATGAGAATTCCGATTTCAAATGGGCAGATAAACCCT

CAGGAAGTCCCTCCTTTTGGAATAGAGATGAAGCCAGTACAAGATTTCGTCCTAGGAAAAGCATGAAGGCCAATAACAGGTTCAGGCATATGGCCAAACA

AGAGGCAAATACCATGCCTAGGCACAAAAACAAACAAGAGTTCTATAATATTTCCAGTTCTGATTCTGAGGATGAGTCTGGTAAAACTCCCTGGTTCTGG

CCCAAAGACAAGACCAAAGTCTGGTCTAAGCCCAAAGAAGAGCCCAATAGTAGGTCCTGGTTTAGGTCTAAGAAAGAAGTCCGTGTTGAATCCACTTCTG

GGTCTGAATGTGAAAATCCTACAAAATCTTTGTTTTGGTCTGGAGAAGAGGCTAAATCTAGATCCAAACCCAGAGCCAGGAAAGGGGTCAATATGAGGGC

CAGGCAGCAGGCCAAGCGAGAAGCTTGCAGTGATGCCATGTCTGGAGCTATAGATACAAATAAGAAAGAGTCCTGGTTCTTGCCTGAAGAGAAAGCTAAT

GTTTTTTCAAAGTCTAAGACAAAGAAAGAGCCCAGAACCAGAGCAGTGCCAAAGGAAGAAGTCAAAACTAAGGCCAGAGCAAGTACCAAGCAAGAAGCCA

GGCCAGAGGAGGAAGTCCTCGTTGGGGCTTGGTTCTGGGACACCCAGGAGTCCACTATGGCAGATAGGATAAGCATCAAGACCACTTTTGTAGAGGAGGA

GCCCATTGTTGGAGATTGGTTCTGGAGTGAAGAAGAAGCCAGTGTGGACTCTGAGACCTGTCATACATCCAGACCCAGGGCTAAGGAGGAGCAAGTTAGT

AGTTTCTGTTTAGGGTCTGGAAAGAAGAGCAGTATGGAAAGTGGGCCAAAGGCTACTTCTAAATCTATGCCAGTAGCTAAGGAGGATGAGGTCGTTATTG

GGTCCTGGTTCTGGGCAGATGATGAAGAGATCAACTTACAGGCTGATGACGAGTCTATTTTTGGATCTTGGTTCTGGGGCACTGGTGAGAACAGCCTTAG

ATCTGTTGGAGTCAATTGTGAGAAGATGCCGAAGGCTGGAGAAAAAGAAGTTACTGATTCCTGGTTCTGGGCTGGAGATGTCAATACAGAGGCTGAGGTT

GAAGAACAGGCCAGGTCGGCATCTACAAAAGCAACAATCTTTGTGCCTTGGTTTTGGTCTGAAAAGCAGCCGAACATGGATTTAGGGTCTGAACCTTGCT

CAGATATCATGGCAGGAGCTGAGGAGGAGCCCATAATTGGGCCCTGGTTCTGGGCTAAAGTAGATAATAGTGTGGAGGCTGAAGTTAACAGTAAGTCTAG

CCTTGAGGATGAGGAAGAACCCATTAGATCCCCTTGGTTTGGGGCCAGAGAACAAACCGATATGAAGTATGCAGCTGGTATCAGATACAAGCCTATGGCA

GAAGCTGAGGATGCTAACAAAAAGTCTTGTGTCTGGGCAAAAGAACCCTGTTTGTATCCTACCAATAGAGAATGCTTGAAATCTACTCTGGGAGAAAAAG

AAGACACTGTTGATCCATGGCTCTGGTCCAATAATTATCCAAGGACCAAGACCATCACAGGGTCCTGGCTATGGGCTGCAGAAGAGGGAAATATAGATGA

TGAGACTGGAGAAAAGATTAAACTACCAACTTTAGAGGACAATGCATTCAATTCTTGGTTCTGGAAAGAAAATGAAGAAAGCATTGTAGAGGCTCCCAAG

AGAGAAGAATTCAGGCCAGAAGCGGAAGAGGAAGACATTATTGGTTCTTGGTTTTGGGCTGGGGATGAAGACAGGTTTGAGCCAGCTGCTAAGATTAATG

AAGAGAACAAGATAGCATCTGAAGATGAAGATACAGTTGGATCCTGGTTCTGGGGCAATGAAGAGGCCAGTCTAGAGGCAGTGAGAAGGGGTACTTTTGA

GTCTGCTCCTGGGATTAAGGAAGAGAAAGTTACTGGGTCATGGTTCTGGACTGATAAGGCCAAAGTAGGGGCTGGGTCCCAGACTGTCGAAACTGGGTCA

GAAACTGAAGAGGAAGCAATTTTTGAGTCCTTGATCTGGGCTGCAAAAAAGGACAGTATTCAAGCAGGAGTAAAGCGTGTGTCCAAGCCAAAAGATGACG

GTAACATAGCTGTTGGGTCCTGGCTCTGGTCTAGTGACAAGGCCACAAAAGAAGCTAAAACTCTGATTGTCAGTGAGGCCAGTCCAGAAAATGGGAAAGA

GTCAGTTGTTAAGTTTGGGTCAAGAGCAAAAGATGAGGTGATTAACAAGACTGGCAGTGGTGACAATTGTAAACATAGTACAGAAGCTGAAACCATAGTG

GGAGCCTGGTTCTGGGAAGGAGATGAAGCTAGCTTTGAATCAAATCCTGTACCTGTATGCAAGGCCGTTTGTGAACCCGAGTCTTCAGCTGAGCACGAAC

CTGACCCTTCCCGCAGGCCTCAGAGCTGGGATGAGGTCACTGTTCAGTTTAAGGCTGGTCCGTGGGGAAAAGCTGGCTTCCCACCCATGAACCCCTTCAG

ATTCCCCAAAGAAGCGGCATCTCTGTTTGCAGAAATGTTTGGGGGAAAGCCTAAGCTTGTGGAAGTTGGTCCAGAAAGGGAGCCTGAACCCCAGTTCCCA

TTTCAGTATGATCCCTCTTACCGCTCAGTCCGAGAAATTCGCGAGCATCTTAAGGCCAGGGAAAGTGCACAGCCAGAGAATTGGTCTTGCAACTGCATCC

AGTGTGAGCTTAGAATTGGTTCTGAGGAGTTTGAGGAGCTTCTTTTACTGATGGACAGAAATCGTGATCCTTTTATCCATGAGATATCTAAGATTGCAAT

GGGCATGCGAGGTGCTTCTCAGTTTACCCGGGATTTCATTCGAAACTCGGGCGTTGTCTCCCTGATTGAAGCCTTACTTAACTATCCGTCCTCCCGAGTG

AGGACAAGGTTTTTGGAAAATATGGTCCGCATGGCTCCCCCTTATCCAGACCTGAACATGATTGAGACATACGTGTGTCAGATTTGCGAGGACACCTTTG

ACTATGACTTGGATTCCCCTGATCAGTTGTCCGGATTGACAATGATTACACACCTCACTGCTACTTCTGACTATCACAAGGTGGTTGTCAATTACTTGGC

TGGGTTTTTCTACTTACTGAATTCAGGCAATACCAAAACAAGGTTTCATGTTCTGAAACTGCTACTGAATTTGTCTGAAAACCTTGTCATGACAAAACGC

CTACTTGTTACTGATTCGGTGTCAGAATTTATGGACCTTATTAATAGGGAGGAGTCAGATGAAAACATTCAAATTGTTCTTGCAATATTTGAGACTATCA

GTAAACATATTCAAAAAGAGGCACTGTTTTCTGATGATGATGATGATGATGAAGAAGAAGATGCAGTGAATCTTGAACCATTTATTTCTGCATTCCGTGA

GGCTGAAAAAATTGCCAAGGAACTAAAACGCAAACCTGGCAATCAAAAAGCACCCTGAAGCAGTACAACAAAAACAAAAAGTAATTTGACTAACCCTTTG

CCTCCGGTTGTCCTTTTGTTCCTGAGTCATCTGACCCTCAAATACTGCTTTGCTTTCCCAGCTGCTTCCTTGTTTCAGTGTACCTCTCTAATGCTGGTGG

CAATTCTACCCAACCCTGTGTACTCTGTATTATCGTTCTGATGCCAAATGAAGATACAACTGAAAACACATGACACTTGTTGATGACGCTTGTTGTGTTG

ATTGTGATGTTCAGTATTTGAGTGTAAAGTGAACTGAGCCGTTGTAAATAAGATGCCCTTCTAAATGTTGTTCTCGTGTATATTTGAGTCTTGTGCTTCA

ATAAAGGTCTATGTGAAAGTG
Translation
      MTRAEVEPGAQAKAENKPGDENANAAEVEPEAPLVVRPKVRTQIMTGARPKVKPKGTPGARPKGETSTPGGAYAKCKPKAIPIARSKHDAQVWA

PNKFRGESMSKMGKQCQISAADPPLLSNDSGMVAQAKCLPVDRELANMDTESIPKKANSPAGFQPSYGSEEGTNMGSWYRARPVPKGEAYENSDFKWADK

PSGSPSFWNRDEASTRFRPRKSMKANNRFRHMAKQEANTMPRHKNKQEFYNISSSDSEDESGKTPWFWPKDKTKVWSKPKEEPNSRSWFRSKKEVRVEST

SGSECENPTKSLFWSGEEAKSRSKPRARKGVNMRARQQAKREACSDAMSGAIDTNKKESWFLPEEKANVFSKSKTKKEPRTRAVPKEEVKTKARASTKQE

ARPEEEVLVGAWFWDTQESTMADRISIKTTFVEEEPIVGDWFWSEEEASVDSETCHTSRPRAKEEQVSSFCLGSGKKSSMESGPKATSKSMPVAKEDEVV

IGSWFWADDEEINLQADDESIFGSWFWGTGENSLRSVGVNCEKMPKAGEKEVTDSWFWAGDVNTEAEVEEQARSASTKATIFVPWFWSEKQPNMDLGSEP

CSDIMAGAEEEPIIGPWFWAKVDNSVEAEVNSKSSLEDEEEPIRSPWFGAREQTDMKYAAGIRYKPMAEAEDANKKSCVWAKEPCLYPTNRECLKSTLGE

KEDTVDPWLWSNNYPRTKTITGSWLWAAEEGNIDDETGEKIKLPTLEDNAFNSWFWKENEESIVEAPKREEFRPEAEEEDIIGSWFWAGDEDRFEPAAKI

NEENKIASEDEDTVGSWFWGNEEASLEAVRRGTFESAPGIKEEKVTGSWFWTDKAKVGAGSQTVETGSETEEEAIFESLIWAAKKDSIQAGVKRVSKPKD

DGNIAVGSWLWSSDKATKEAKTLIVSEASPENGKESVVKFGSRAKDEVINKTGSGDNCKHSTEAETIVGAWFWEGDEASFESNPVPVCKAVCEPESSAEH

EPDPSRRPQSWDEVTVQFKAGPWGKAGFPPMNPFRFPKEAASLFAEMFGGKPKLVEVGPEREPEPQFPFQYDPSYRSVREIREHLKARESAQPENWSCNC

IQCELRIGSEEFEELLLLMDRNRDPFIHEISKIAMGMRGASQFTRDFIRNSGVVSLIEALLNYPSSRVRTRFLENMVRMAPPYPDLNMIETYVCQICEDT

FDYDLDSPDQLSGLTMITHLTATSDYHKVVVNYLAGFFYLLNSGNTKTRFHVLKLLLNLSENLVMTKRLLVTDSVSEFMDLINREESDENIQIVLAIFET

ISKHIQKEALFSDDDDDDEEEDAVNLEPFISAFREAEKIAKELKRKPGNQKAP

For any suggestions or comments, please send an email to unitrap@crg.es