Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000043541 (Casc1)
Chromosomal location
Chr 6: 145123354 - 145159490 (-)
Description
cancer susceptibility candidate 1 Gene [Source:MGI (curated);Acc:Casc1-001]
RefSeq_dna
NM_177222 
RefSeq_peptide
NP_796196.2 
MGI
MGI:2444480 
Uniprot/SWISSPROT
Q6TDU8 
Uniprot/SPTREMBL
B2KFC0 Q675B2 Q675B3 B2KFB8 B2KFB9 
Human Ortholog
ENSG00000118307 (CASC1)
Omim not available
UniTrap UNI29163
Vector Insertion
Chr 6: 145127695 - 145130278
Public Clones not available
Private Clones OST6994 (lexicon)
Severity of mutation (?) Insertion after 65% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13872
Vector Insertion
Chr 6: 145123845 - 145124691
Public Clones CMHD-GT_215H7-3 (cmhd) CMHD-GT_116A5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28249
Vector Insertion
Chr 6: 145123845 - 145124691
Public Clones not available
Private Clones OST36046 (lexicon) OST13480 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13806
Vector Insertion
Chr 6: 145123463 - 145123845
Public Clones CMHD-GT_217G7-3 (cmhd) CMHD-GT_239H5-3 (cmhd) CMHD-GT_97G2-3 (cmhd) CMHD-GT_218B9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29062
Vector Insertion
Chr 6: 145123353 - 145126021
Public Clones not available
Private Clones OST9930 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000060797
Sequence
GACTTGGGCAGTACTCACCGGAAGACTACAGTGCGATTGCGCAGGTTGTCCTTCGCAAAACACTGGGAGTTGTGAGTGGGCGTGGCCTGTCGTCTTGACA

ACCGTGAGCGTTCCTGCTCTGCAGAGTTCACTTATCCCTAAGCAAAGTTCCTGCTTCTGTCATG GCTCCCAAATCAAAAAAG GCTCCCAGTAAGAAAA

AGATGACCAAAGCCGAGCGACTGCGGCTGATGCAGGAGGAGGAGGAGAGACGCCTGAAGGAGGAAG AAGAGGCGCGGCTGAAATTTGAAAAAGAAGAAC

AGGAAAGGCTAGAAATACAGCGGATTGAGAGAGAGAAGTGGAGTCTGCTGGAAAAGAAA GACCTAGAACGAAGAAGCCAAGAGCTTGAAGAGCTTGCTC

TGCTCGAGGGTTGTTTTCCTGAAGCAGAGAAACAGAAGCGGGAAATTCGAGCTCTGGCTCAG TGGAAGCACTACACGGAGTGTGATGGGAGCCCCGACC

CTTGGGTTGCCCAGGAAATGAACACGTTCATTAGCCTGTGGGAAGAGGAGAAGAACCAGGCCTTTGAACAAGTGATGGAGAAAAGCAAACTGGTGCTGTC

G TTGATTGAAAAGGTGAAGTTAATTTTACTGGAAACTCCGACATATGAGCTGGACCACAGGACTGTCCTGCAGCATCAAGGGTCAATTCTGCGCCTACA

AGAGCTGCTCAGCCTGAAGATCAACGTGGCCACAGAACTACTTCTTCGA CAAGCTAGTAACTTAGCAGATCTGGACACTGGGAATATGGAGAAAATCAT

CAAAGATGAGAATGTCACCCTGTACGTGTGGGCAAACCTCAAAAAGAATCCAAG GCACCGGAGTGTGAGGTTCTCAGAGACACAAATTGGATTTGAAAT

CCCAAGGATCCTGGCCACGAGCAATGTTGCTCTTCGGCTTCTACACACACGCTATGACCACATCACACCCTTGTTCCCCATTGCCGTCACTGAGCAAAAT

CAGAACCCCGTGGGAGCAGAGCAAGTCAACGTCGAGGAAAGTACAGAAAAGGCCATGACTGAAGAAAAGCTCTTTACTGAAGAAAAAGCTGCCAACGAAG

ATGAGCAGCCCAAGGCTGAACAGGAAAGAGAGCTCAACTTGGTTCAAGAGGAGAACAAATATGAAGCTATAGAGAACACTGTCTTACAAAGG ACTTCCG

ACTCTGAAGGGGAGGATTCCCAAACCACCCAACTTGAACTGGAGATGAAGCTGCTGAGTGAAGCAGTCTTAGCAG CACAGCTGTGCCTGGTAGAGAATG

TGGTGGAATTGCCAGAAGCCTCACAAGCCTACAAGGTGGACTTGTGCCATTTCTCTACCCTGGGCGGCGTGTACCACCTGGATGTTCTGGAGCTGCCCCC

TCAGTGCAAGCCTGTGAAGGGCTGGGTGCTAGTGGAG ATACTCCAGGAAGGACTGCAGAGGTTTATATATCCTCCAGACACCACAGAGGAACCTGATCC

AGACGTCACCTTCCCACCCATAGAGGTCACACTGGAGATCCACAAGAGCGTCATCTTCTTTGAGCGCCCTAGGGTCGTCAGGTGGGACAATGAAG - UN

I29163 - GTAAATTCTGGCGGTCAGATGGCATCAGCAGTGTCTATTACAACCGAGAAGACAGGCTCCTAACCTTCAGTATGGATACTTTGGGCCCTGT

GACCTTGATTCAGGATGCTCACGTGAACATGCCTTACCAGTCCTGGGAGATGAGTCCCTGTGGCATGAACAAAGTCCTTCTAATAGTGAAGACGGTTTTC

ATGGAGCTCCAGATATACATCAAG - UNI29062 - GAAAACCTCTGCATGCTGGCTTCAGTGAAACTGAGGGGCAAGGGACTCGAGTTTCATCTAAA

AGGAAAATGGATGGCTCCTATACCCTTCATTCTGGCTTTGAAAGAGGCCGGGCTGAACATCTTCCCTGCTGTATACTCCCATTTTTATGTGGTCATCAAC

AATAAG - UNI29062 - GTACCCCAGGTGGAGTTGAAGGCCTATCGGCAAATGGCCCTGCTGAGCTCTGCCTTCTCGTTTGGCTGGAGCAAGTGGAA

CATGGTCTGCAATTCCACAAGGGTTGTGATTCGG - UNI13806 - - UNI13872 - - UNI28249 - - UNI29062 - GTGAGGGAACAAC

TGTCAGAAGAAACAGAGCACCATACCTGGTCGCTCCTCATGTTCAGTGGTGACAGAGCGCAGATGCTCAAGATGCAGGAAGAGAACGACAAGTTCTCGGA

GGCCCTCAGGGAGGGCACCGAGTTCCACTCCACCTTGTACCACATGATGAAGGACTTCGCCTCCCCCGTGGCAATGGAGAGGGTCAGGCATTCGAACTGC

CAGTTCATCGACTCAGTGTGCTACATGCTGCTGTCTATCCGCGTCCTCAGCTATTCCTAGCTATTCCTAGCCCTTACAGCGTGTGTAAGCATGGTGGACC

CTTATACCGAGAGGAATCAGGTATCTTTCCAGTCAGCCGCTAAAGTGATTTAAGAGCACCAGGCGTTC
Translation
M APKSKK APSKKKMTKAERLRLMQEEEERRLKEEE EEARLKFEKEEQERLEIQRIEREKWSLLEKK DLERRSQELEELALLEGCFPEAEKQKREIR

ALAQ WKHYTECDGSPDPWVAQEMNTFISLWEEEKNQAFEQVMEKSKLVLS LIEKVKLILLETPTYELDHRTVLQHQGSILRLQELLSLKINVATELLL

R QASNLADLDTGNMEKIIKDENVTLYVWANLKKNPR RHRSVRFSETQIGFEIPRILATSNVALRLLHTRYDHITPLFPIAVTEQNQNPVGAEQVNVEE

STEKAMTEEKLFTEEKAANEDEQPKAEQERELNLVQEENKYEAIENTVLQR TSDSEGEDSQTTQLELEMKLLSEAVLAA AQLCLVENVVELPEASQAY

KVDLCHFSTLGGVYHLDVLELPPQCKPVKGWVLVE ILQEGLQRFIYPPDTTEEPDPDVTFPPIEVTLEIHKSVIFFERPRVVRWDNEG - UNI29163

 - GKFWRSDGISSVYYNREDRLLTFSMDTLGPVTLIQDAHVNMPYQSWEMSPCGMNKVLLIVKTVFMELQIYIK - UNI29062 - ENLCMLASVKL

RGKGLEFHLKGKWMAPIPFILALKEAGLNIFPAVYSHFYVVINNK - UNI29062 - VPQVELKAYRQMALLSSAFSFGWSKWNMVCNSTRVVIR - 

UNI13806 - - UNI13872 - - UNI28249 - - UNI29062 - VREQLSEETEHHTWSLLMFSGDRAQMLKMQEENDKFSEALREGTEFHSTL

YHMMKDFASPVAMERVRHSNCQFIDSVCYMLLSIRVLSYS
Transcript ENSMUST00000057366
Sequence
GACTTGGGCAGTACTCACCGGAAGACTACAGTGCGATTGCGCAGGTTGTCCTTCGCAAAACACTGGGAGTTGTGAGTGGGCGTGGCCTGTCGTCTTGACA

ACCGTGAGCGTTCCTGCTCTGCAGAGTTCACTTATCCCTAAGCAAAGTTCCTGCTTCTGTCATG GCTCCCAAATCAAAAAAG GCTCCCAGTAAGAAAA

AGATGACCAAAGCCGAGCGACTGCGGCTGATGCAGGAGGAGGAGGAGAGACGCCTGAAGGAGGAAG AAGAGGCGCGGCTGAAATTTGAAAAAGAAGAAC

AGGAAAGGCTAGAAATACAGCGGATTGAGAGAGAGAAGTGGAGTCTGCTGGAAAAGAAA GACCTAGAACGAAGAAGCCAAGAGCTTGAAGAGCTTGCTC

TGCTCGAGGGTTGTTTTCCTGAAGCAGAGAAACAGAAGCGGGAAATTCGAGCTCTGGCTCAG TGGAAGCACTACACGGAGTGTGATGGGAGCCCCGACC

CTTGGGTTGCCCAGGAAATGAACACGTTCATTAGCCTGTGGGAAGAGGAGAAGAACCAGGCCTTTGAACAAGTGATGGAGAAAAGCAAACTGGTGCTGTC

G TTGATTGAAAAGGTGAAGTTAATTTTACTGGAAACTCCGACATATGAGCTGGACCACAGGACTGTCCTGCAGCATCAAGGGTCAATTCTGCGCCTACA

AGAGCTGCTCAGCCTGAAGATCAACGTGGCCACAGAACTACTTCTTCGA CAAGCTAGTAACTTAGCAGATCTGGACACTGGGAATATGGAGAAAATCAT

CAAAGATGAGAATGTCACCCTGTACGTGTGGGCAAACCTCAAAAAGAATCCAAG GCACCGGAGTGTGAGGTTCTCAGAGACACAAATTGGATTTGAAAT

CCCAAGGATCCTGGCCACGAGCAATGTTGCTCTTCGGCTTCTACACACACGCTATGACCACATCACACCCTTGTTCCCCATTGCCGTCACTGAGCAAAAT

CAGAACCCCGTGGGAGCAGAGCAAGTCAACGTCGAGGAAAGTACAGAAAAGGCCATGACTGAAGAAAAGCTCTTTACTGAAGAAAAAGCTGCCAACGAAG

ATGAGCAGCCCAAGGCTGAACAGGAAAGAGAGCTCAACTTGGTTCAAGAGGAGAACAAATATGAAGCTATAGAGAACACTGTCTTACAAAGG ACTTCCG

ACTCTGAAGGGGAGGATTCCCAAACCACCCAACTTGAACTGGAGATGAAGCTGCTGAGTGAAGCAGTCTTAGCAG CACAGCTGTGCCTGGTAGAGAATG

TGGTGGAATTGCCAGAAGCCTCACAAGCCTACAAGGTGGACTTGTGCCATTTCTCTACCCTGGGCGGCGTGTACCACCTGGATGTTCTGGAGCTGCCCCC

TCAGTGCAAGCCTGTGAAGGGCTGGGTGCTAGTGGAG ATACTCCAGGAAGGACTGCAGAGGTTTATATATCCTCCAGACACCACAGAGGAACCTGATCC

AGACGTCACCTTCCCACCCATAGAGGTCACACTGGAGATCCACAAGAGCGTCATCTTCTTTGAGCGCCCTAGGGTCGTCAGGTGGGACAATGAAG - UN

I29163 - GTAAATTCTGGCGGTCAGATGGCATCAGCAGTGTCTATTACAACCGAGAAGACAGGCTCCTAACCTTCAGTATGGATACTTTGGGCCCTGT

GACCTTGATTCAGGATGCTCACGTGAACATGCCTTACCAGTCCTGGGAGATGAGTCCCTGTGGCATGAACAAAGTCCTTCTAATAGTGAAGACGGTTTTC

ATGGAGCTCCAGATATACATCAAG - UNI29062 - GAAAACCTCTGCATGCTGGCTTCAGTGAAACTGAGGGGCAAGGGACTCGAGTTTCATCTAAA

AGGAAAATGGATGGCTCCTATACCCTTCATTCTGGCTTTGAAAGAGGCCGGGCTGAACATCTTCCCTGCTGTATACTCCCATTTTTATGTGGTCATCAAC

AATAAG - UNI13806 - - UNI13872 - - UNI28249 - - UNI29062 - GTGAGGGAACAACTGTCAGAAGAAACAGAGCACCATACCTG

GTCGCTCCTCATGTTCAGTGGTGACAGAGCGCAGATGCTCAAGATGCAGGAAGAGAACGACAAGTTCTCGGAGGCCCTCAGGGAGGGCACCGAGTTCCAC

TCCACCTTGTACCACATGATGAAGGACTTCGCCTCCCCCGTGGCAATGGAGAGGGTCAGGCATTCGAACTGCCAGTTCATCGACTCAGTGTGCTACATGC

TGCTGTCTATCCGCGTCCTCAGCTATTCCTAGCTATTCCTAGCCCTTACAGCGTGTGTAAGCATGGTGGACCCTTATACCGAGAGGAATCAGGTATCTTT

CCAGTCAGCCGCTAAAGTGATTTAAGAGCACCAGGCGTTC
Translation
  MTKAERLRLMQEEEERRLKEEE EEARLKFEKEEQERLEIQRIEREKWSLLEKK DLERRSQELEELALLEGCFPEAEKQKREIRALAQ WKHYTECD

GSPDPWVAQEMNTFISLWEEEKNQAFEQVMEKSKLVLS LIEKVKLILLETPTYELDHRTVLQHQGSILRLQELLSLKINVATELLLR QASNLADLDTG

NMEKIIKDENVTLYVWANLKKNPR RHRSVRFSETQIGFEIPRILATSNVALRLLHTRYDHITPLFPIAVTEQNQNPVGAEQVNVEESTEKAMTEEKLFT

EEKAANEDEQPKAEQERELNLVQEENKYEAIENTVLQR TSDSEGEDSQTTQLELEMKLLSEAVLAA AQLCLVENVVELPEASQAYKVDLCHFSTLGGV

YHLDVLELPPQCKPVKGWVLVE ILQEGLQRFIYPPDTTEEPDPDVTFPPIEVTLEIHKSVIFFERPRVVRWDNEG - UNI29163 - GKFWRSDGIS

SVYYNREDRLLTFSMDTLGPVTLIQDAHVNMPYQSWEMSPCGMNKVLLIVKTVFMELQIYIK - UNI29062 - ENLCMLASVKLRGKGLEFHLKGKW

MAPIPFILALKEAGLNIFPAVYSHFYVVINNK - UNI13806 - - UNI13872 - - UNI28249 - - UNI29062 - VREQLSEETEHHTWS

LLMFSGDRAQMLKMQEENDKFSEALREGTEFHSTLYHMMKDFASPVAMERVRHSNCQFIDSVCYMLLSIRVLSYS
Transcript ENSMUST00000111728
Sequence
GAGGGAGACAGGAAAGGGGCAAGTGCGGATTCCACTTCAGCGCTGTCGAGGGAGGGCAGGCAGACAGGGGCAGTGCGATCCAGAGGTGGCGAGATCCAGA

TCTTTGCAGTGACTAAACTTTACTAGCTTCCGGTGATGTACATTCCCACTTTGGCTCTGACTGCCTTGTCAGAAAAGTTTTCATTCCAACGCAGAACAAT

ATGGAGCAAATTTCGTGTGTTGTTTCCCATTCTCCATCAAGAGATCATCAATTATCACACTCGTTGAGGGGAGATTCAGAGTGCATTATTTGTGTTTGCT

GGCTGGAAGCCAGAGACACACAAAGGAGAATATTACAGCCCTCCGGCTCTGTCAGTTAAGCAGAATATCAGACACAAGCTTTACCAAG GCTCCCAAATC

AAAAAAG GCTCCCAGTAAGAAAAAGATGACCAAAGCCGAGCGACTGCGGCTGATGCAGGAGGAGGAGGAGAGACGCCTGAAGGAGGAAG AAGAGGCGC

GGCTGAAATTTGAAAAAGAAGAACAGGAAAGGCTAGAAATACAGCGGATTGAGAGAGAGAAGTGGAGTCTGCTGGAAAAGAAA GACCTAGAACGAAGAA

GCCAAGAGCTTGAAGAGCTTGCTCTGCTCGAGGGTTGTTTTCCTGAAGCAGAGAAACAGAAGCGGGAAATTCGAGCTCTGGCTCAG TGGAAGCACTACA

CGGAGTGTGATGGGAGCCCCGACCCTTGGGTTGCCCAGGAAATGAACACGTTCATTAGCCTGTGGGAAGAGGAGAAGAACCAGGCCTTTGAACAAGTGAT

GGAGAAAAGCAAACTGGTGCTGTCG TTGATTGAAAAGGTGAAGTTAATTTTACTGGAAACTCCGACATATGAGCTGGACCACAGGACTGTCCTGCAGCA

TCAAGGGTCAATTCTGCGCCTACAAGAGCTGCTCAGCCTGAAGATCAACGTGGCCACAGAACTACTTCTTCGA CAAGCTAGTAACTTAGCAGATCTGGA

CACTGGGAATATGGAGAAAATCATCAAAGATGAGAATGTCACCCTGTACGTGTGGGCAAACCTCAAAAAGAATCCAAG GCACCGGAGTGTGAGGTTCTC

AGAGACACAAATTGGATTTGAAATCCCAAGGATCCTGGCCACGAGCAATGTTGCTCTTCGGCTTCTACACACACGCTATGACCACATCACACCCTTGTTC

CCCATTGCCGTCACTGAGCAAAATCAGAACCCCGTGGGAGCAGAGCAAGTCAACGTCGAGGAAAGTACAGAAAAGGCCATGACTGAAGAAAAGCTCTTTA

CTGAAGAAAAAGCTGCCAACGAAGATGAGCAGCCCAAGGCTGAACAGGAAAGAGAGCTCAACTTGGTTCAAGAGGAGAACAAATATGAAGCTATAGAGAA

CACTGTCTTACAAAGG ACTTCCGACTCTGAAGGGGAGGATTCCCAAACCACCCAACTTGAACTGGAGATGAAGCTGCTGAGTGAAGCAGTCTTAGCAG 

CACAGCTGTGCCTGGTAGAGAATGTGGTGGAATTGCCAGAAGCCTCACAAGCCTACAAGGTGGACTTGTGCCATTTCTCTACCCTGGGCGGCGTGTACCA

CCTGGATGTTCTGGAGCTGCCCCCTCAGTGCAAGCCTGTGAAGGGCTGGGTGCTAGTGGAG ATACTCCAGGAAGGACTGCAGAGGTTTATATATCCTCC

AGACACCACAGAGGAACCTGATCCAGACGTCACCTTCCCACCCATAGAGGTCACACTGGAGATCCACAAGAGCGTCATCTTCTTTGAGCGCCCTAGGGTC

GTCAGGTGGGACAATGAAG - UNI29163 - GTAAATTCTGGCGGTCAGATGGCATCAGCAGTGTCTATTACAACCGAGAAGACAGGCTCCTAACCTT

CAGTATGGATACTTTGGGCCCTGTGACCTTGATTCAGGATGCTCACGTGAACATGCCTTACCAGTCCTGGGAGATGAGTCCCTGTGGCATGAACAAAGTC

CTTCTAATAGTGAAGACGGTTTTCATGGAGCTCCAGATATACATCAAG - UNI29062 - GAAAACCTCTGCATGCTGGCTTCAGTGAAACTGAGGGG

CAAGGGACTCGAGTTTCATCTAAAAGGAAAATGGATGGCTCCTATACCCTTCATTCTGGCTTTGAAAGAGGCCGGGCTGAACATCTTCCCTGCTGTATAC

TCCCATTTTTATGTGGTCATCAACAATAAG - UNI13806 - - UNI13872 - - UNI28249 - - UNI29062 - GTGAGGGAACAACTGTC

AGAAGAAACAGAGCACCATACCTGGTCGCTCCTCATGTTCAGTGGTGACAGAGCGCAGATGCTCAAGATGCAGGAAGAGAACGACAAGTTCTCGGAGGCC

CTCAGGGAGGGCACCGAGTTCCACTCCACCTTGTACCACATGATGAAGGACTTCGCCTCCCCCGTGGCAATGGAGAGGGTCAGGCATTCGAACTGCCAGT

TCATCGACTCAGTGTGCTACATGCTGCTGTCTATCCGCGTCCTCAGCTATTCCTAGCTATTCCTAGCCCTTACAGCGTGTGTAAGCATGGTGGACCCTTA

TACCGAGAGGAATCAGGTATCTTTCCAGTCAGCCGCTAAAGTGATTTAAGAGCACCAGGCGTTCCAGCCACACTGCACAAAGATTTGAATGGTCTTTATT

TGGATACATCTCAATAAAGTCTGATGCCTCTCACTCAGAAAGCTCATTAAAATACCCTAGGTGGGGTCCCCTCC
Translation
  MTKAERLRLMQEEEERRLKEEE EEARLKFEKEEQERLEIQRIEREKWSLLEKK DLERRSQELEELALLEGCFPEAEKQKREIRALAQ WKHYTECD

GSPDPWVAQEMNTFISLWEEEKNQAFEQVMEKSKLVLS LIEKVKLILLETPTYELDHRTVLQHQGSILRLQELLSLKINVATELLLR QASNLADLDTG

NMEKIIKDENVTLYVWANLKKNPR RHRSVRFSETQIGFEIPRILATSNVALRLLHTRYDHITPLFPIAVTEQNQNPVGAEQVNVEESTEKAMTEEKLFT

EEKAANEDEQPKAEQERELNLVQEENKYEAIENTVLQR TSDSEGEDSQTTQLELEMKLLSEAVLAA AQLCLVENVVELPEASQAYKVDLCHFSTLGGV

YHLDVLELPPQCKPVKGWVLVE ILQEGLQRFIYPPDTTEEPDPDVTFPPIEVTLEIHKSVIFFERPRVVRWDNEG - UNI29163 - GKFWRSDGIS

SVYYNREDRLLTFSMDTLGPVTLIQDAHVNMPYQSWEMSPCGMNKVLLIVKTVFMELQIYIK - UNI29062 - ENLCMLASVKLRGKGLEFHLKGKW

MAPIPFILALKEAGLNIFPAVYSHFYVVINNK - UNI13806 - - UNI13872 - - UNI28249 - - UNI29062 - VREQLSEETEHHTWS

LLMFSGDRAQMLKMQEENDKFSEALREGTEFHSTLYHMMKDFASPVAMERVRHSNCQFIDSVCYMLLSIRVLSYS
Transcript ENSMUST00000111727
Sequence
TTTAACGTTGTGGTCTTTGTTAAGGCTCCCAGTAAGAAAAAGATGACCAAAGCCGAGCGACTGCGGCTGATGCAGGAGGAGGAGGAGAGACGCCTGAAGG

AGGAAG AAGAGGCGCGGCTGAAATTTGAAAAAGAAGAACAGGAAAGGCTAGAAATACAGCGGATTGAGAGAGAGAAGTGGAGTCTGCTGGAAAAGAAA 

GACCTAGAACGAAGAAGCCAAGAGCTTGAAGAGCTTGCTCTGCTCGAGGGTTGTTTTCCTGAAGCAGAGAAACAGAAGCGGGAAATTCGAGCTCTGGCTC

AG TGGAAGCACTACACGGAGTGTGATGGGAGCCCCGACCCTTGGGTTGCCCAGGAAATGAACACGTTCATTAGCCTGTGGGAAGAGGAGAAGAACCAGG

CCTTTGAACAAGTGATGGAGAAAAGCAAACTGGTGCTGTCG TTGATTGAAAAGGTGAAGTTAATTTTACTGGAAACTCCGACATATGAGCTGGACCACA

GGACTGTCCTGCAGCATCAAGGGTCAATTCTGCGCCTACAAGAGCTGCTCAGCCTGAAGATCAACGTGGCCACAGAACTACTTCTTCGA CAAGCTAGTA

ACTTAGCAGATCTGGACACTGGGAATATGGAGAAAATCATCAAAGATGAGAATGTCACCCTGTACGTGTGGGCAAACCTCAAAAAGAATCCAAG GCACC

GGAGTGTGAGGTTCTCAGAGACACAAATTGGATTTGAAATCCCAAGGATCCTGGCCACGAGCAATGTTGCTCTTCGGCTTCTACACACACGCTATGACCA

CATCACACCCTTGTTCCCCATTGCCGTCACTGAGCAAAATCAGAACCCCGTGGGAGCAGAGCAAGTCAACGTCGAGGAAAGTACAGAAAAGGCCATGACT

GAAGAAAAGCTCTTTACTGAAGAAAAAGCTGCCAACGAAGATGAGCAGCCCAAGGCTGAACAGGAAAGAGAGCTCAACTTGGTTCAAGAGGAGAACAAAT

ATGAAGCTATAGAGAACACTGTCTTACAAAGG ACTTCCGACTCTGAAGGGGAGGATTCCCAAACCACCCAACTTGAACTGGAGATGAAGCTGCTGAGTG

AAGCAGTCTTAGCAG CACAGCTGTGCCTGGTAGAGAATGTGGTGGAATTGCCAGAAGCCTCACAAGCCTACAAGGTGGACTTGTGCCATTTCTCTACCC

TGGGCGGCGTGTACCACCTGGATGTTCTGGAGCTGCCCCCTCAGTGCAAGCCTGTGAAGGGCTGGGTGCTAGTGGAG ATACTCCAGGAAGGACTGCAGA

GGTTTATATATCCTCCAGACACCACAGAGGAACCTGATCCAGACGTCACCTTCCCACCCATAGAGGTCACACTGGAGATCCACAAGAGCGTCATCTTCTT

TGAGCGCCCTAGGGTCGTCAGGTGGGACAATGAAG - UNI29163 - GTAAATTCTGGCGGTCAGATGGCATCAGCAGTGTCTATTACAACCGAGAAG

ACAGGCTCCTAACCTTCAGTATGGATACTTTGGGCCCTGTGACCTTGATTCAGGATGCTCACGTGAACATGCCTTACCAGTCCTGGGAGATGAGTCCCTG

TGGCATGAACAAAGTCCTTCTAATAGTGAAGACGGTTTTCATGGAGCTCCAGATATACATCAAG - UNI29062 - GAAAACCTCTGCATGCTGGCTT

CAGTGAAACTGAGGGGCAAGGGACTCGAGTTTCATCTAAAAGGAAAATGGATGGCTCCTATACCCTTCATTCTGGCTTTGAAAGAGGCCGGGCTGAACAT

CTTCCCTGCTGTATACTCCCATTTTTATGTGGTCATCAACAATAAGGCAAGAATGTATCTCTCTAAATTTAATGTAGTGGGAACCAAGGACGCTGCTGCA

GTTCAACTGTGTCAGGGAAAACACCAGGAACCCAGGTTCCTCTCAGCTAAGATCAGCAGTGTGGTGAGGGGGGTTTGCGGTCCACACCGTCACTGCTGTG

CATTGTCTTCGTTTTCATGCAGGGACCACCAGCCCACACAAACACGTCCCCATGGCTGTGTGCTGTTCTGTGCTGCTCCAGGGACTTGGCTCATGAGTTC

CTGTGTGAATTTGGGGCTCCTAGAGAATAGGGCTTGCAGATGGCTCTAGCAGCCAGCCTGGCCCCAGAGTGCAGGCACCTGGTAAAGCCCCGTGGTGATA

AATGGAAACGCAAGTGCTCAGATTTGTAGGCAGAAGAGCTCTGTACCCAAGAACACCGCCACCACTCTCTGGGGCCCTTTCGCCTGTCAGTAACTGCGTA

ACACCTGTCAATCGTGTCCTGAGGGTCTGGACGTAAATGCATAGGTAGAAAGGTTTGCAGAGTTAACTGTACTTACTGCTCTGTTCCTGCCCCTGCCCTG

GGAGCAACCTTCTACCAGAGAAAGGAACATAATTGAAATGGTCCTGAAAAGTAGGACCACACACAGTCCTCAGCAGGGTGCCGCGTAGAGCCTTGGACCG

CAAGGTGTGTGGCCATCAGAGCTGGAGAGTGAGGTGGGTATGCCTCAGGGGGTGTTGGGGAGGAGGCTCGCTAGGTGGAAAGCACAGCTGCAGCCACACC

CTGGGAGAGCAGCCCTCGGTCTGGTCTGCTCTGCCTACGCTAGGCTAGGAAGGATGCAACGGTAGGGGTCGGCTCACAGAGGTCAGCTCACAACAGCCTT

AGTGGACACTCTTCACCTTAGGGGGTGTGCAGAAAGGGAAAACCATTGCCTAATTTTGAGAGTAGAGCCACAGAATCCGATTTCAACCTTGAAACGAACC

CTTCTGTCTGAAGGACAGACTACAGAGAGGTCTGATGGAGACGACGCTTGCGGGACATTGTAAGACTGACTGTACGTATCCTCCCGTGGACAGGTACCCC

AGGTGGAGTTGAAGGCCTATCGGCAAATGGCCCTGCTGAGCTCTGCCTTCTCGTTTGGCTGGAGCAAGTGGAACATGGTCTGCAATTCCACAAGGGTTGT

GATTCGGGTAAAGTGTGCAAACCCAGAACCTAGAAAACACCCGAGAAGGGAGGGAGGGTGTGGCCCCCTCCACCTCTCAAAGATGTGAAATGAGCATTCA

AAACCAAGTTCTCAAGTTCTGAGTTCTAGCCTCTCAGACCTTCACCACTATAGTGCCAAATGCCGTGCCATTGTGTCTGTGTTGACTCCAGAGCAAACAG

GAAAACCATGTGTGTGGGAGTGTCTGTGTGGCTCATAGCCCTCTACGGAGGCCAGGCATTCAGCATAACTTCTGACACATCACTGTGTATGAGTAGGAAG

GACACTGTTTTCATGCTCAAGGTTGACTGAGTTTCTCTCCGAGTTGTGTGGGAAGCCAGGGTCTCATACACGTTGTGTACCAAGTGCCCCACCCCTGAGC

TCCGCCCCTGAGCTCCGCCCAAGCTCCACCCCCCAGCTCCATTCCCGAACTCCACCCATGAGCTGTAAAGCTGTAAAGCTTTCCTTGTTGCTCCCTACTT

GAGTACAGCCTCCTTGAGAGCTGGGTCTCACTGATGCAACCAGTGTCTCTGGTTTGGGTGCCCGCTGCGCCCTCATCTCCCAGAGCGGTAGCTGGGCACA

GCATAGGCACCCGGGTACCAACCAATGCTTGCTAGATGCTTCATGGTTTAAAGCAGTTCAGAACCACAGCACGCAGAGTGCCTTTTGCTATGTTTGCCAA

CATGCTCCTTTCCTTCCAGCACTGGGGAGGCTGAGCCAGCCTGGTCTACCTCATGAGAGACTTATCTGCAAGCTGGGTAATTTGGGTACCCAGCAGTTCC

ATCTTCCTTCCTTGTGTATGTTTGGCAATCCCAGAATTCACGTTCTCTTTCTAGGTGAGGGAACAACTGTCAGAAGAAACAGAGCACCATACCTGGTCGC

TCCTCATGTTCAGTGGTGACAGAGCGCAGATGCTCAAGATGCAGGAAGAGAACGACAAGTTCTCGGAGGCCCTCAGGGAGGGCACCGAGTTCCACTCCAC

CTTGTACCACATGATGAAGGACTTCGCCTCCCCCGTGGCAATGGAGAGGGTCAGGCATTCGAACTGCCAGTTCATCGACTCAGTGTGCTACATGCTGCTG

TCTATCCGCGTCCTCAGCTATTCCTAGCTATTCCTAGCCCTTACAGCGTGTGTAAGCATGGTGGACCCTTATACCGAGAGGAATCAGGTATCTTTCCAGT

CAGCCGCTAAAGTGATTTAAGAGCACCAGGCGTTCCAGCCACACTGCACAAAGATTTGAATGGTCTTTATTTGGATACATCTCAATAAAGTCTGATGCCT

CTCACTCAGAAAGCTCATTAAAATACCCTAGGTGGGGTCCCCTCC
Translation
MTKAERLRLMQEEEERRLKEEE EEARLKFEKEEQERLEIQRIEREKWSLLEKK DLERRSQELEELALLEGCFPEAEKQKREIRALAQ WKHYTECDGS

PDPWVAQEMNTFISLWEEEKNQAFEQVMEKSKLVLS LIEKVKLILLETPTYELDHRTVLQHQGSILRLQELLSLKINVATELLLR QASNLADLDTGNM

EKIIKDENVTLYVWANLKKNPR RHRSVRFSETQIGFEIPRILATSNVALRLLHTRYDHITPLFPIAVTEQNQNPVGAEQVNVEESTEKAMTEEKLFTEE

KAANEDEQPKAEQERELNLVQEENKYEAIENTVLQR TSDSEGEDSQTTQLELEMKLLSEAVLAA AQLCLVENVVELPEASQAYKVDLCHFSTLGGVYH

LDVLELPPQCKPVKGWVLVE ILQEGLQRFIYPPDTTEEPDPDVTFPPIEVTLEIHKSVIFFERPRVVRWDNEG - UNI29163 - GKFWRSDGISSV

YYNREDRLLTFSMDTLGPVTLIQDAHVNMPYQSWEMSPCGMNKVLLIVKTVFMELQIYIK - UNI29062 - ENLCMLASVKLRGKGLEFHLKGKWMA

PIPFILALKEAGLNIFPAVYSHFYVVINNKARMYLSKFNVVGTKDAAAVQLCQGKHQEPRFLSAKISSVVRGVCGPHRHCCALSSFSCRDHQPTQTRPHG

CVLFCAAPGTWLMSSCVNLGLLENRACRWL

For any suggestions or comments, please send an email to unitrap@crg.es