Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000043993 (2900052L18Rik)
Chromosomal location
Chr 11: 120091193 - 120092899 (-)
Description
RIKEN cDNA 2900052L18 gene Gene [Source:MGI Symbol;Acc:MGI:1924085]
UniGene
Mm.394084 Mm.472955 
MGI
MGI:1924085 
Uniprot/SPTREMBL
Q8BSB8 Q8CEV4 
Human Ortholog
not available
Omim not available
UniTrap UNI31211
Vector Insertion
Chr 11: 120091192 - 120092900
Public Clones IST14705D9 (tigm) IST10340D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000062283
Sequence
AAGGCTGCCCAAGGCCGCTTGATGAAAGGAGATAAACCGGGGACGGTTTCCAGGATCCCCGCGGGCCGACCCAGGCAGCTCGGGAGCCGAG - UNI312

11 - GCCGCCGGACGGGGAACACAAGCCTGACTGCGGGGTGGAGGCGCGAGGCCAGCCCGGGATTGCGCCCTCTCCAGCGCGGTGATTGCTGCGCGCCG

GGGCGCACGAGCTGCGGTGAGGCACATCTCCTGCAGATCCAGTACGCGATTGAATCAGGCCATCCTGTGAGGGATGGGCGCGAATTCCGGCTCCCGGTGG

CTCGGTGGTGACCCGACGGCGAACGCCGGCCGGGCTTGGCCTGAGGTGAGCTCCGTTGTTCTGGTCCCTCCAGCGGCGGGCAGCCGTTTCCCGCTTCGCA

CGCACGGAGAGAAGATTCCCGGCTCGGGAGAAACCGCTGCTGGCAACGGGAGGCCCCGGAACGCGAGCGCCCCTGTTCTCGGTTGGTGTAAGCATCTCTT

GCAAGCCGCAGATTTTCTGAGTGCTTGGAATTCGAGTTCCTCGCTATTTTCTTTCACTGATTTTGTTTACCGATCCAGGAATCTTTATATCTATCTCCCC

GTTTAAAGTATTCTCCCTTACCCCATCCGTCCCTTCAAAAAGAAAAAGAAAAAGGGAAAAGGATTTTAAAAAAAGAGAGAGAGAGAAATAATTGGATGCT

ACAAGGACACAGCGTGGCAATCCTCCGAGCTGCTGCAACCTCGAGGGGACCCGGGAAGCCAGTGTGGGGGAGGGGCGCGCCTAGACAGCTTGCACCCACT

CTTTGATTTTGCGTAACCCGGGTCCTCTAGGCTGGACCGGGAAGATCTCCAAGTGTGGGATCTATCCCTCCAGGGCGGGTGGAGATGGTCAGAAGGGCAC

ACCGGTAATCCATCTGCACACAGGCCTGCTGCTAGACACGAGAACGCGAGGTTTCTTTCCTCCTCAAGCCGGTTTAGAATCTTGGGGATCAGCACCGCCG

GATCCCTAAAAGCTGGGCAGGAGGATTTGTCTCCAACCCCGCCATGTTCTGTGTCCACCCCAACCCCGTTCTGTGTCGTCTCACATCCCCGAAAGGCTCC

CAGAGTGTGAAAGGCCTCGGCTCCTTGCTGTCTCGCTCCCACCTCTGCGTCCTCTCTAACCTCAGTATTCACTTAAGTCTAGTGGCCTTTTTCCTCCTTC

GCTCAATACTGTTTCAAAATAGTTGTTACAGCAAATAGCTGCCGACGCGCCTCTGGATGCCGCCAGAGGCTGGCAGCTGCCCAGCGCGGGCGCACAGCCC

CCGGCAGTTCCACAAGACCAAAATAAGCTCCCGTGTTCCTCTCACAGGGCTCGGCCTCCCGGGCGGGCCCGGGCATGTCTGGCTGGGCTCGCTATCTGCT

TGGAGCAAACCATCCTGGTTTCCTCCTTGACTTCCTGCTATCCAAAACTAACAAATGTTTTTCATTTTAGAAGAACATGGCGTGAGGATCAGGGTCCTTT

CTAGAGCAGTGCTTCTCACCCTTCC
Translation
 - UNI31211 - MGANSGSRWLGGDPTANAGRAWPEVSSVVLVPPAAGSRFPLRTHGEKIPGSGETAAGNGRPRNASAPVLGWCKHLLQAADFLSAWN

SSSSLFSFTDFVYRSRNLYIYLPV

For any suggestions or comments, please send an email to unitrap@crg.es