Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044066 (Cep68)
Chromosomal location
Chr 11: 20128509 - 20149421 (-)
Description
centrosomal protein 68 Gene [Source:MGI (curated);Acc:Cep68-001]
RefSeq_dna
NM_172260 
RefSeq_peptide
NP_758464.2 
UniGene
Mm.260314 
MGI
MGI:2667663 
Uniprot/SWISSPROT
Q8C0D9 
Uniprot/SPTREMBL
Q3TRP8 Q3ULV4 Q6A043 Q3UFW2 
Human Ortholog
ENSG00000011523 (CEP68)
Omim not available
UniTrap UNI4738
Vector Insertion
Chr 11: 20149309 - 20149375
Public Clones XP0205 (sanger) AS0590 (sanger) NPX206 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23572
Vector Insertion
Chr 11: 20142242 - 20149309
Public Clones (sanger) E087G01 (ggtc) IST10871G3 (tigm) IST14802C3 (tigm) IST10937F1 (tigm)
IST14710H10 (tigm)
Private Clones OST252800 (lexicon) OST239500 (lexicon) OST211693 (lexicon) OST191629 (lexicon)
OST115799 (lexicon) OST97763 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23809
Vector Insertion
Chr 11: 20140702 - 20141888
Public Clones IST12986B8 (tigm)
Private Clones OST244226 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6372
Vector Insertion
Chr 11: 20138592 - 20139198
Public Clones YHC146 (baygenomics) A006F02 (ggtc) IST10752A6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30691
Vector Insertion
Chr 11: 20136008 - 20138592
Public Clones IST10457A11HMF1 (tigm) IST10457A11 (tigm) IST12587F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5091
Vector Insertion
Chr 11: 20130598 - 20136008
Public Clones (sanger) YTC650 (baygenomics) XC762 (baygenomics) IST12720E6 (tigm)
IST10231F2 (tigm) IST12355F11 (tigm) IST11551C6 (tigm) IST11991F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10085
Vector Insertion
Chr 11: 20130430 - 20130598
Public Clones XC755 (baygenomics) XC757 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16579
Vector Insertion
Chr 11: 20129485 - 20130426
Public Clones E041H03 (ggtc) D124F03 (ggtc) IST12267D9 (tigm)
Private Clones OST457884 (lexicon) OST405079 (lexicon) OST357484 (lexicon) OST348582 (lexicon)
OST37906 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109596
Sequence
CTGGCCCTCCCTCCCCAGGAGTGCGGGCGCCCGCGGGAGGCCCCGTCGTCGCCGCCTGGGACCCTGGCCCAGCTACGCGGGTCGCTCGGGACGTGCGGCG

GTGTGGAGTGAG - UNI4738 - - UNI23572 - GTTCCTGAAGGCTTCAAAGGAAACCTGATAGAGGAGGCTCAATGGCCCTGAGTGAAGATGAG

GCTGAGGCAGAAGTGTCTGTCAACACAAAGGTCCCATCCTGTGGCAGGTGGAACTCTGGGAAGCTGCTGCCCTCAGGGCTTGAACCAGATCAGCCCCTAC

ATCTGGGTGTTGAGGGGGGGCCACTGTGGAGGGCTGAAGCTGACCCTGGCTGCATCTCGGGAGTTTTCTTGTCACGGGTCCATACTGCCAGCAAAGAACC

AGTAGCAGATAGGTCTAAGCCTCCCCTCAGAGGCCCGCTTCCTTCTGCCAGTGTGGGCACTGGAGAGGTTTTACACTCTATGGGCAGCCAA - UNI238

09 - ATGGAGGAAGACAGGCTTCCTGCCTCCCAGGACCTACTTCCAGCTCTTCAAGTCTTTGGAACTATAACTGTTTGCTCAGGACAGGAGGCTGACAG

TGAAGACTTCCAGGCTACGCTTGATCCATCTCAGGTGTTGGGCCTCAGCCAGCAACCACACACCTCAGGTCTCCCTCTCCCGCCACAGTGGAAGTCCACG

GTGAGCCCAGGTGCTCCTCAGCTTTCTAGCAGAAGCATCTCTGCCTCCTCGGTGGGCAGCAGTCTTCAGGATCACCAAGAGAAGGCAGGACCTCAGAGGG

CCTCTTTTGCCAATGTCTCCTCTCCCGAGTTGACTGTACCCCAGGCAGCCCACTCTGTGGTGGGGGCAGGGCCTCCGCTCCAGGGGTCAGCACAGCCTCT

GACCTCTGGCAGTGATGCTACAGGCCTGGGTAAGAGACACCTCTCCTTTCAGGCAGAATACTGGGCCTGTGCGCTGCCAAATTCTCTGCCTCCTTCCCCT

AACCGCCACTCCGCACTCTGGGACCCAAATAAAGAGTATGAAGATCTGCTTGACTACACTTACCCACTGAGGCCTGGGCCTCAGCTCCCAAAGCAACCTG

AAAGTCATGTCCTGACTGAGCCTGTTCTGCAGGACTCAGGTGTAGATCTGGACAGTTTGTCTGTCTCCCCAGCAAGTACTCTAAAGTCACCCACTAATGT

CTCCCACAATTGCTCATCAGCAGAAGTGCCTACTCTGCCATTTTCTGGAGCCAGAGAGTCATGTCTTAAGCGCTGGCCCTTGGGAATATTCCAGAAACAG

GGTGGCACAAGCTTGTCATCCTGGAACCAGCTTGCATCAACCCCTAGAGCCCCAGGCACTGAAGATGCTTCTTGGGAGAACAGAGAGGCAGCCCTGAGGG

GCACAGCGGAGGACTGCCTCCCTATAGGTGAGGACCTCCGAATGGGCTCTCCCCAGCTGAAGACGAAGGAGAAAGAGCCACCCTTTCCCAGACAGAAGAG

AGGCAGGCAGCATGTTAGCTGCCCGGCCTGTGTGACGCCTGGATGGCCATCAGAAGAGGAGGTGGGAAGTGATGAGGAGTACCTTGCTCTGCCCACCAGG

CTGACTCAGGTCTCTAGTTTGGTGTCCTACTCAGGTGCCAGGCCCTCCTTTGTGAACCTACACACTGGGGCTGCTGAGGAACACAGTTCACTACAAGTCT

CAGACAGTGACAAGCCAGCCTCCCCCACATTGGACTCCAGCCACAGGAAGCATCCTTCTGGAACTTCCTTTCAAGGGCCTGTGGGCCAGAACCCCTGCTT

CAGGCATTCTATCCAGCCCCAGGACTCTAGAGGCAAAAGTAGTCTGATGAGTAACCAGACCCTCGGGGTCTCTTCAAAACCACTGAAAACTCAGCCCGCC

TCAAAAGCCATGACGGACAGGCGGCTGTTCTCCGAGCTAGTAGCTGGAGAGACACTTCCCAGGACGACAGATGAGCAGGAGAAAGCTTCTCTAGTGCAGT

GTGTGCAG - UNI6372 - - UNI30691 - ACATTTTGCTGTCGGCTGGAAGAGCTGATCTGCTGGTTGTATAATGTCACAGATGTTGCTGACCTC

AGTGCTCCACCCAGGACCAGCCTTACAGGTCTCAAGTCTTCTCTGCAGCTTTACAGGGTAATATGTAGTCCTGGCTTGTTTATCCACGGGGATGGGAGTT

AAGTCACTTTTACAAAATAAAATCTCAAGTAACTGGA
Translation
 - UNI4738 - - UNI23572 - MALSEDEAEAEVSVNTKVPSCGRWNSGKLLPSGLEPDQPLHLGVEGGPLWRAEADPGCISGVFLSRVHTASKEP

VADRSKPPLRGPLPSASVGTGEVLHSMGSQ - UNI23809 - MEEDRLPASQDLLPALQVFGTITVCSGQEADSEDFQATLDPSQVLGLSQQPHTSGL

PLPPQWKSTVSPGAPQLSSRSISASSVGSSLQDHQEKAGPQRASFANVSSPELTVPQAAHSVVGAGPPLQGSAQPLTSGSDATGLGKRHLSFQAEYWACA

LPNSLPPSPNRHSALWDPNKEYEDLLDYTYPLRPGPQLPKQPESHVLTEPVLQDSGVDLDSLSVSPASTLKSPTNVSHNCSSAEVPTLPFSGARESCLKR

WPLGIFQKQGGTSLSSWNQLASTPRAPGTEDASWENREAALRGTAEDCLPIGEDLRMGSPQLKTKEKEPPFPRQKRGRQHVSCPACVTPGWPSEEEVGSD

EEYLALPTRLTQVSSLVSYSGARPSFVNLHTGAAEEHSSLQVSDSDKPASPTLDSSHRKHPSGTSFQGPVGQNPCFRHSIQPQDSRGKSSLMSNQTLGVS

SKPLKTQPASKAMTDRRLFSELVAGETLPRTTDEQEKASLVQCVQ - UNI6372 - - UNI30691 - TFCCRLEELICWLYNVTDVADLSAPPRTS

LTGLKSSLQLYRVICSPGLFIHGDGS
Transcript ENSMUST00000050611
Sequence
CTGGCCCTCCCTCCCCAGGAGTGCGGGCGCCCGCGGGAGGCCCCGTCGTCGCCGCCTGGGACCCTGGCCCAGCTACGCGGGTCGCTCGGGACGTGCGGCG

GTGTGGAGTGAG - UNI4738 - - UNI23572 - GTTCCTGAAGGCTTCAAAGGAAACCTGATAGAGGAGGCTCAATGGCCCTGAGTGAAGATGAG

GCTGAGGCAGAAGTGTCTGTCAACACAAAGGTCCCATCCTGTGGCAGGTGGAACTCTGGGAAGCTGCTGCCCTCAGGGCTTGAACCAGATCAGCCCCTAC

ATCTGGGTGTTGAGGGGGGGCCACTGTGGAGGGCTGAAGCTGACCCTGGCTGCATCTCGGGAGTTTTCTTGTCACGGGTCCATACTGCCAGCAAAGAACC

AGTAGCAGATAGGTCTAAGCCTCCCCTCAGAGGCCCGCTTCCTTCTGCCAGTGTGGGCACTGGAGAGGTTTTACACTCTATGGGCAGCCAA - UNI238

09 - ATGGAGGAAGACAGGCTTCCTGCCTCCCAGGACCTACTTCCAGCTCTTCAAGTCTTTGGAACTATAACTGTTTGCTCAGGACAGGAGGCTGACAG

TGAAGACTTCCAGGCTACGCTTGATCCATCTCAGGTGTTGGGCCTCAGCCAGCAACCACACACCTCAGGTCTCCCTCTCCCGCCACAGTGGAAGTCCACG

GTGAGCCCAGGTGCTCCTCAGCTTTCTAGCAGAAGCATCTCTGCCTCCTCGGTGGGCAGCAGTCTTCAGGATCACCAAGAGAAGGCAGGACCTCAGAGGG

CCTCTTTTGCCAATGTCTCCTCTCCCGAGTTGACTGTACCCCAGGCAGCCCACTCTGTGGTGGGGGCAGGGCCTCCGCTCCAGGGGTCAGCACAGCCTCT

GACCTCTGGCAGTGATGCTACAGGCCTGGGTAAGAGACACCTCTCCTTTCAGGCAGAATACTGGGCCTGTGCGCTGCCAAATTCTCTGCCTCCTTCCCCT

AACCGCCACTCCGCACTCTGGGACCCAAATAAAGAGTATGAAGATCTGCTTGACTACACTTACCCACTGAGGCCTGGGCCTCAGCTCCCAAAGCAACCTG

AAAGTCATGTCCTGACTGAGCCTGTTCTGCAGGACTCAGGTGTAGATCTGGACAGTTTGTCTGTCTCCCCAGCAAGTACTCTAAAGTCACCCACTAATGT

CTCCCACAATTGCTCATCAGCAGAAGTGCCTACTCTGCCATTTTCTGGAGCCAGAGAGTCATGTCTTAAGCGCTGGCCCTTGGGAATATTCCAGAAACAG

GGTGGCACAAGCTTGTCATCCTGGAACCAGCTTGCATCAACCCCTAGAGCCCCAGGCACTGAAGATGCTTCTTGGGAGAACAGAGAGGCAGCCCTGAGGG

GCACAGCGGAGGACTGCCTCCCTATAGGTGAGGACCTCCGAATGGGCTCTCCCCAGCTGAAGACGAAGGAGAAAGAGCCACCCTTTCCCAGACAGAAGAG

AGGCAGGCAGCATGTTAGCTGCCCGGCCTGTGTGACGCCTGGATGGCCATCAGAAGAGGAGGTGGGAAGTGATGAGGAGTACCTTGCTCTGCCCACCAGG

CTGACTCAGGTCTCTAGTTTGGTGTCCTACTCAGGTGCCAGGCCCTCCTTTGTGAACCTACACACTGGGGCTGCTGAGGAACACAGTTCACTACAAGTCT

CAGACAGTGACAAGCCAGCCTCCCCCACATTGGACTCCAGCCACAGGAAGCATCCTTCTGGAACTTCCTTTCAAGGGCCTGTGGGCCAGAACCCCTGCTT

CAGGCATTCTATCCAGCCCCAGGACTCTAGAGGCAAAAGTAGTCTGATGAGTAACCAGACCCTCGGGGTCTCTTCAAAACCACTGAAAACTCAGCCCGCC

TCAAAAGCCATGACGGACAGGCGGCTGTTCTCCGAGCTAGTAGCTGGAGAGACACTTCCCAGGACGACAGATGAGCAGGAGAAAGCTTCTCTAGTGCAGT

GTGTGCAG - UNI6372 - - UNI30691 - ACATTTTGCTGTCGGCTGGAAGAGCTGATCTGCTGGTTGTATAATGTCACAGATGTTGCTGACCTC

AGTGCTCCACCCAGGACCAGCCTTACAGGTCTCAAGTCTTCTCTGCAGCTTTACAGG - UNI30691 - CAATTTAAGAAAGATGTAGACGAACATCA

GTCCCTGACAGAGAGCGTCTTGGAGAAGGGAGAGATTCTTCTTCAGTGCCTGTTGGATAACACCCCAG - UNI5091 - - UNI10085 - - UNI3

0691 - TTTTAAAGGATGTCCTTGAGAGGATTGCAAAGCAGTCTGGTGAGCTGGAGAGCCGTGCAGATCATCTTTATGACTCTATCTTAGCCTCTTTGG

ACATGTTGGCTGGCTGCACCCTCATCCCTGACAACAGGCCAACAGCAGCAGAACACCCACATGAAGGGCTTTAACACA - UNI16579 - GCAGAGGT

GGAGTCATTGGCGAGATGGCAGCTGGAAAGAAAACTCAAGAACTCCTTGTAAGAGCCATGGAAGTTAAGGAAGGGGAGGAAATCAACTTGAACACACGTT

AAGATGCCTTTCTCGCCTCTGAAGGATCCTGAGTCACTGCCCTCATTTACTATGAATCCCTCCAAAATTAAGGCCGTTTCTATGGTGCTTCTCTACAATA

ATTATGTGGCTTTATAATTAGTTGATAAAATATTAAGACTTGTGGGTCTCGTGTTTAAAAACCAGCAGATAAAATGTGTTGAGGCCATTTACAGAAAGCT

GCTGGAGAAAGGTTCTACGTACTTAGGATTCTCAGGCATACAGGGGGATGGGATCTAAGAGAGAAAATGTTAGTGGCCAAAACTGTAGAGTGAAATGCTC

ACCCTTAGTAAGTCGGGAGAACCTCTACAGAGTCCTAGGAGTTGCCACCTATAGTGGTCAGTCTCCACTTCAACCATGTCAAGAATGCTCAGGAGCTGGC

CTGCCATGCTTCTGAACTGCATGCTTGTGCTAACCTCTGGGGATCTCAGGCCACAGTTCTCTTCCCCTTGGAAGACTAGTCAGAGGACTGGGCCGGGTAG

AGACAGCCACATGGTCTGTGCGTACGTAAATTAAAGCAGCCATTGGTGATGAAAAGCGGGGAGTCTTTGTAGTTTGGGAGTGAACAGGAAGTTGTGCCTT

GTCAGGAAGAAAAGAATTCTATGGACCTATCATAGGTCCATATGTTCAAAGCATCAGTTACAGCTTTCCAAGCAAAGTGTTTGTATGTTGGCTACCACAA

ATTCCACAAAGTATCAAAGGTGGGCTTTTCAGGTTTAAAAAAAAAATAGCTATTTAGATAAGCATGTACATGACTTTAATCCTAGTACTTAAAAGTAGCT

CTGTGAGTTTGAGGACAGTCTGGCTTGTTTATTAGAGTCCAGGCTGCCAGGGCTTTATAAAGAAGAAG
Translation
 - UNI4738 - - UNI23572 - MALSEDEAEAEVSVNTKVPSCGRWNSGKLLPSGLEPDQPLHLGVEGGPLWRAEADPGCISGVFLSRVHTASKEP

VADRSKPPLRGPLPSASVGTGEVLHSMGSQ - UNI23809 - MEEDRLPASQDLLPALQVFGTITVCSGQEADSEDFQATLDPSQVLGLSQQPHTSGL

PLPPQWKSTVSPGAPQLSSRSISASSVGSSLQDHQEKAGPQRASFANVSSPELTVPQAAHSVVGAGPPLQGSAQPLTSGSDATGLGKRHLSFQAEYWACA

LPNSLPPSPNRHSALWDPNKEYEDLLDYTYPLRPGPQLPKQPESHVLTEPVLQDSGVDLDSLSVSPASTLKSPTNVSHNCSSAEVPTLPFSGARESCLKR

WPLGIFQKQGGTSLSSWNQLASTPRAPGTEDASWENREAALRGTAEDCLPIGEDLRMGSPQLKTKEKEPPFPRQKRGRQHVSCPACVTPGWPSEEEVGSD

EEYLALPTRLTQVSSLVSYSGARPSFVNLHTGAAEEHSSLQVSDSDKPASPTLDSSHRKHPSGTSFQGPVGQNPCFRHSIQPQDSRGKSSLMSNQTLGVS

SKPLKTQPASKAMTDRRLFSELVAGETLPRTTDEQEKASLVQCVQ - UNI6372 - - UNI30691 - TFCCRLEELICWLYNVTDVADLSAPPRTS

LTGLKSSLQLYR - UNI30691 - QFKKDVDEHQSLTESVLEKGEILLQCLLDNTPV - UNI5091 - - UNI10085 - - UNI30691 - VL

KDVLERIAKQSGELESRADHLYDSILASLDMLAGCTLIPDNRPTAAEHPHEGL - UNI16579 - 
Transcript ENSMUST00000116392
Sequence
GTCGCCGCCTGGGACCCTGGCCCAGCTACGCGGGTCGCTCGGGACGTGCGGCGGTGTGGAGTGAG - UNI4738 - - UNI23572 - GTTCCTGAA

GGCTTCAAAGGAAACCTGATAGAGGAGGCTCAATGGCCCTGAGTGAAGATGAGGCTGAGGCAGAAGTGTCTGTCAACACAAAGGTCCCATCCTGTGGCAG

GTGGAACTCTGGGAAGCTGCTGCCCTCAGGGCTTGAACCAGATCAGCCCCTACATCTGGGTGTTGAGGGGGGGCCACTGTGGAGGGCTGAAGCTGACCCT

GGCTGCATCTCGGGAGTTTTCTTGTCACGGGTCCATACTGCCAGCAAAGAACCAGTAGCAGATAGGTCTAAGCCTCCCCTCAGAGGCCCGCTTCCTTCTG

CCAGTGTGGGCACTGGAGAGGTTTTACACTCTATGGGCAGCCAA - UNI23809 - ATGGAGGAAGACAGGCTTCCTGCCTCCCAGGACCTACTTCCA

GCTCTTCAAGTCTTTGGAACTATAACTGTTTGCTCAGGACAGGAGGCTGACAGTGAAGACTTCCAGGCTACGCTTGATCCATCTCAGGTGTTGGGCCTCA

GCCAGCAACCACACACCTCAGGTCTCCCTCTCCCGCCACAGTGGAAGTCCACGGTGAGCCCAGGTGCTCCTCAGCTTTCTAGCAGAAGCATCTCTGCCTC

CTCGGTGGGCAGCAGTCTTCAGGATCACCAAGAGAAGGCAGGACCTCAGAGGGCCTCTTTTGCCAATGTCTCCTCTCCCGAGTTGACTGTACCCCAGGCA

GCCCACTCTGTGGTGGGGGCAGGGCCTCCGCTCCAGGGGTCAGCACAGCCTCTGACCTCTGGCAGTGATGCTACAGGCCTGGGTAAGAGACACCTCTCCT

TTCAGGCAGAATACTGGGCCTGTGCGCTGCCAAATTCTCTGCCTCCTTCCCCTAACCGCCACTCCGCACTCTGGGACCCAAATAAAGAGTATGAAGATCT

GCTTGACTACACTTACCCACTGAGGCCTGGGCCTCAGCTCCCAAAGCAACCTGAAAGTCATGTCCTGACTGAGCCTGTTCTGCAGGACTCAGGTGTAGAT

CTGGACAGTTTGTCTGTCTCCCCAGCAAGTACTCTAAAGTCACCCACTAATGTCTCCCACAATTGCTCATCAGCAGAAGTGCCTACTCTGCCATTTTCTG

GAGCCAGAGAGTCATGTCTTAAGCGCTGGCCCTTGGGAATATTCCAGAAACAGGGTGGCACAAGCTTGTCATCCTGGAACCAGCTTGCATCAACCCCTAG

AGCCCCAGGCACTGAAGATGCTTCTTGGGAGAACAGAGAGGCAGCCCTGAGGGGCACAGCGGAGGACTGCCTCCCTATAGGTGAGGACCTCCGAATGGGC

TCTCCCCAGCTGAAGACGAAGGAGAAAGAGCCACCCTTTCCCAGACAGAAGAGAGGCAGGCAGCATGTTAGCTGCCCGGCCTGTGTGACGCCTGGATGGC

CATCAGAAGAGGAGGTGGGAAGTGATGAGGAGTACCTTGCTCTGCCCACCAGGCTGACTCAGGTCTCTAGTTTGGTGTCCTACTCAGGTGCCAGGCCCTC

CTTTGTGAACCTACACACTGGGGCTGCTGAGGAACACAGTTCACTACAAGTCTCAGACAGTGACAAGCCAGCCTCCCCCACATTGGACTCCAGCCACAGG

AAGCATCCTTCTGGAACTTCCTTTCAAGGGCCTGTGGGCCAGAACCCCTGCTTCAGGCATTCTATCCAGCCCCAGGACTCTAGAGGCAAAAGTAGTCTGA

TGAGTAACCAGACCCTCGGGGTCTCTTCAAAACCACTGAAAACTCAGCCCGCCTCAAAAGCCATGACGGACAGGCGGCTGTTCTCCGAGCTAGTAGCTGG

AGAGACACTTCCCAGGACGACAGATGAGCAGGAGAAAGCTTCTCTAGTGCAGTGTGTGCAG - UNI6372 - - UNI30691 - ACATTTTGCTGTC

GGCTGGAAGAGCTGATCTGCTGGTTGTATAATGTCACAGATGTTGCTGACCTCAGTGCTCCACCCAGGACCAGCCTTACAGGTCTCAAGTCTTCTCTGCA

GCTTTACAGG - UNI30691 - CAATTTAAGAAAGATGTAGACGAACATCAGTCCCTGACAGAGAGCGTCTTGGAGAAGGGAGAGATTCTTCTTCAGT

GCCTGTTGGATAACACCCCAG - UNI5091 - - UNI10085 - - UNI30691 - TTTTAAAGGATGTCCTTGAGAGGATTGCAAAGCAGTCTGG

TGAGCTGGAGAGCCGTGCAGATCATCTTTATGACTCTATCTTAGCCTCTTTGGACATGTTGGCTGGCTGCACCCTCATCCCTGACAACAGGCCAACAGCA

GCAGAACACCCACATGAAGGGCTTTAA
Translation
 - UNI4738 - - UNI23572 - MALSEDEAEAEVSVNTKVPSCGRWNSGKLLPSGLEPDQPLHLGVEGGPLWRAEADPGCISGVFLSRVHTASKEP

VADRSKPPLRGPLPSASVGTGEVLHSMGSQ - UNI23809 - MEEDRLPASQDLLPALQVFGTITVCSGQEADSEDFQATLDPSQVLGLSQQPHTSGL

PLPPQWKSTVSPGAPQLSSRSISASSVGSSLQDHQEKAGPQRASFANVSSPELTVPQAAHSVVGAGPPLQGSAQPLTSGSDATGLGKRHLSFQAEYWACA

LPNSLPPSPNRHSALWDPNKEYEDLLDYTYPLRPGPQLPKQPESHVLTEPVLQDSGVDLDSLSVSPASTLKSPTNVSHNCSSAEVPTLPFSGARESCLKR

WPLGIFQKQGGTSLSSWNQLASTPRAPGTEDASWENREAALRGTAEDCLPIGEDLRMGSPQLKTKEKEPPFPRQKRGRQHVSCPACVTPGWPSEEEVGSD

EEYLALPTRLTQVSSLVSYSGARPSFVNLHTGAAEEHSSLQVSDSDKPASPTLDSSHRKHPSGTSFQGPVGQNPCFRHSIQPQDSRGKSSLMSNQTLGVS

SKPLKTQPASKAMTDRRLFSELVAGETLPRTTDEQEKASLVQCVQ - UNI6372 - - UNI30691 - TFCCRLEELICWLYNVTDVADLSAPPRTS

LTGLKSSLQLYR - UNI30691 - QFKKDVDEHQSLTESVLEKGEILLQCLLDNTPV - UNI5091 - - UNI10085 - - UNI30691 - VL

KDVLERIAKQSGELESRADHLYDSILASLDMLAGCTLIPDNRPTAAEHPHEGL

For any suggestions or comments, please send an email to unitrap@crg.es