Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044098 (Rsbn1)
Chromosomal location
Chr 3: 103718043 - 103770559 (+)
Description
rosbin, round spermatid basic protein 1 Gene [Source:MGI (curated);Acc:Rsbn1-002]
RefSeq_dna
NM_172684 
RefSeq_peptide
NP_766272.2 
UniGene
Mm.29366 
MGI
MGI:2444993 
Uniprot/SWISSPROT
Q80T69 
Uniprot/SPTREMBL
B0V3N6 
Human Ortholog
ENSG00000081019 (RSBN1)
Omim not available
UniTrap UNI23977
Vector Insertion
Chr 3: 103718042 - 103719077
Public Clones not available
Private Clones OST238962 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106806
Sequence
GTGTTTGTGGGTGAAATGGCTGCGCAGGTCGGAGCGGTTCGCGTAGTACGGGCGGTGGCGGCGCAGGAGGAGCCGGACAAAGAAGGGAAGGAGAAACCCC

ATGTTGGGGTTTCGCCGCGGGGAGTGAAGCGGCAGCGCCGGGCGAGCAGCGGGGGTTCTCAGGAGAAGCGGGGGCGGCCGAGCCAGGACCCCCCTCTCGC

TCCCCCTCATCGGCGGCGTCGTAGCCGCCAACATCCCGGGCCGCTGCCTCCAACGAATGCCGCCCCAACCGTCCCGGGCCCTGTTGAACCTCTGCTCCTG

CCGCCTCCGCCGCCACCGTCGCTGGCACCCGCCGGGCCCACTGTCGCTGCCCCGCTCCCGGCCCCGGGCACCTCGGCCCTCTTCACCTTCTCGCCTCTGA

CGGTGAGCGCGGCCGGGCCCAAGCATAAGGGCCACAAGGAGCGGCACAAGCACCATCACCACCGCGGCTCCGATGGTGACCCCGGCGCCTGCGTTCCGGG

CGATCTCAAGCACAAGGACAAGCAGGAAAACGGCGAAAGGAGCGGAGGGGTGCCTCTGATCAAGGCCCCCAAGAGAG - UNI23977 - AAACAGCAG

ATGAAAATGGTAAAACCCAGAGAGCTGATGATTTTGTCTTGAAGAAAATAAAGAAGAAAAAGAAAAAGAAACATCGAGAAGACATGAGAGGAAGACGCCT

TAAAATGTACAATAAGGAAGTACAAACCGTCTGTGCTGGCCTGACCCGCATCAGCAAAGAAATTCTCACCCAAGGACAGCTAAATAGCACTTCAGGAGTT

AATAAGGAGTCCTTCAGGTATTTGAAGGATGAACAGCTGTGCAGATTAAATTTGGGCATGCAAGAATATCGGGTGCCCCAGGGAGTACAGACACCTTTTA

CAACGCACCAAGAACATTCTATTCGCAGAAATTTCTTAAAAACAGGTACTAAATTTAGCAACTTTATTCACGAAGAACACCAGTCCAATGGGGGTGCTCT

TGTCCTTCATGCATACATGGACGAACTCTCATTTTTGTCTCCAATGGAGATGGAGAGATTTTCTGAGGAGTTTCTTGCTTTGACATTCAGTGAAAATGAG

AAAAACGCTGCGTACTATGCGTTAGCAATAGTGCATGGAGCGGCCGCTTATCTCCCAGACTTCTTGGACTACTTTGCTTTTAATTTTCCCAACACTCCAG

TGAAAATGGAAATTTTGGGCAAGAAAGATATTGAAACAACCACCATTTCAAATTTTCATACTCAG GTCAACAGGACATATTGCTGTGGTACCTACCGAG

CAGGTCCTATGCGGCAGATAAGTCTTGTTGGAGCAGTAGATGAAGAAGTTGGTGATTATTTCCCAGAGTTCCTAGATATGCTAGAAGAATCACCATTTCT

GAAA ATGACTTTGCCCTGGGGTACACTTTCCAGCCTCCAGCTACAATGTAGGTCTCAGAGCGATGACGGGCCTATAATGTGGGTGAGGCCAGGAGAACA

GATGATCCCTACAGCAGATATGCCAAAGTCACCCTTCAAAAGACGACG ATCAATGAATGAAATTAAAAATCTCCAGTACCTACCTCGGACAAGTGAACC

CCGAGAAGTCCTCTTTGAAGACAGGACCAGAGCTCATGCTGATCATGTAGGTCAGGGGTTTGACTGGCAAAGTACGGCTGCTGTTGGGGTTTTGAAGGCT

GTACAATTCGGTGAATG GAGTGATCAGCCTCGCATAACCAAAGATGTGATTTGTTTTCATGCTGAGGATTTTACTGATGTTGTACAGAGACTTCAGTTA

GACCTTCATGAACCTCCAGTTTCTCAG TGTGTACAGTGGGTGGATGAAGCAAAACTAAACCAAATGAGGCGAGAAGGCATTCGCTATGCTAGAATTCAG

CTTTGCGACAATGATATCTACTTCATCCCTAGAAATGTCATTCATCAGTTCAAAACAGTGTCAGCAGTATGCAGCCTAGCCTGGCATATAAGGCTTAAAC

AATACCACCCTGTTGTGGAAACCGCTCAAAACACAGAGAGCAATTCCAACATGGATTGTGGTTTAGAAGTTGACTCCCAGTGTGTGAGAATAAAAACTGA

ATCTGAGGAAAGATGCACAGAGATGCAGCTTTTGACAACTGCTTCACCGTCTTTCCCACCTCCATCAGAACTTCATCTACAGGATCTGAAGACTCAGCCT

CTTCCAGTTTTCAAGGTGGAGAGCAGACTGGACTCTGACCAGCAACACAGTCTGCAGGCACATCCAAGCACTCCTGTGTGACATGTACATATTCAAACAC

ATTTTTTAACTTTTTTAAATTTTGATGTGAAGTTATAGTTTTATAACTGGCTTAAGTTAAGTTTTATTGGAGAAATCTTGCCTATAATTCTATAAAGAGA

AATGACATTCCACAAATGTCAAGCATATCTTTTTTACACAGATTATGCAAAGCTAAGAGTTGTATCGTTAGTACAGTATGTAATAGTGGGTCTGCTGCTA

CTTTCTGTTTTAAGGTGTGAGGTTACAATTCAATCTCTTCTTCAAATCAAAAAAAGAATTCTCTGGAATAGCAGGTTCTTACTTGGTATTTACTTCCCTT

GATTTTATCTTTCCTTGTCTCTTGCCATATTTGCTTTATGTGGTAGAAAGCAGATTTATGGTTTAATACTTGTGTCTTCATGGCACCTCGTTAGTTTCCA

CAGTAAAATGATATTTGGTTGCAGGAAAGGCTCCTGCATCTGGTACATGGACAAGTGAGTTGTTTAGTTCTAACCACAAAGAAGACATGGTCTCTAAAGA

AAACTCTCTGGCTTCTGGTTTTCAGCAAAAGAGGAAACACAGCATTCTCTGATCCAGGCCGTCTTTTTGTGTCTGTTATTTAAAACCCAGTGGCTACTTC

AATTAAACAAACCTCTAAAGATGACAAACAAAAATCTAAACATTGGCTATACATGATCCATGGTTCATTGATCTTTTCTAGGATATTTACTAACTATACA

GGCTGTTTTGAGGAGGAGAGATAATGCTGACCTGTTGTGCTTCCTAGTATCCTCATATCAAAGTTAGAGAACTGCACCAGTCTTACTGATGAGGGCTGCC

ACAGCTGAGCATCAAACTAAGGAGAAACTATTCTTGTGACTTGGCATCTACTTTTGAAAACACTTTACAATTTTATCAGGCTAATAATACCTGGGTTTGT

TCATTGTTATTCAGTGTTGCTATTTTCTAATAGCAGGCATTAGACTTCCATCCTAGTTTCAGGTAGGCTGAAACTTAGTGTCTGGATATTTACTTTGTTT

TCCCTTTTTCAAACAGACCTCCTTCATCCAAGTAGTGTGGCTCTTATTTTGGAATGTTCATGTGCTATGCATTATCCTTTCTCTAGTTATCAACTTGGTA

GGCCTTTTGTTTACTAAAGGAAGAGTACTCTCCACACCTGAGACCAGATTCTTGTATCTACCTGGTTACAGTGCAATTTGATTTTTTTTTCCTGGATGGT

GAGATTTGAGTTATTTGCATTAACATAGGCGAAAGAAAAAGATGCTGCTTTGTTATGTCTGTCACCATGGAAACTTCGCTGCATCTTTGGAAATATCAAA

TATGAATTTTCTCTAAAATATTCTGAAATAGGTTAAATCTTATATAAATATTACTTTGTGCAATATTGTTGTGTAGTTAAATGCATATTAGCAAAGTATA

GAGGTCACTGTGTAAACCGATAGAAAAGTAACCATCAGCAAATACTACAGTGATTAGTTAGAATCTGTATTATTCCTTATATATATGTATATGTGTGTAT

TCTCTGTTACAAAGGATGAAGACAAATAAATAGGGAAACACTTCAATGTAAACCATTTATGAATTGGAAGTGATGTTGCTTTTAGTTATCTTTGTAAATA

AGGTAATTAGAATGGTATGAAAGGTAATGTGATTATTACAGGGGTGTTTTTAAATCCTGTGTATAAATTCTAGGGTAAATTCTAGTTTATCAAACTAGTT

TTTAAGGGACCTTTGAGGGTATTTTTTGTTGTTATTTTGTGGAGAAAAGGGGCATATCACAAAATGAATGGGTTTGGGTTATTTCTTATTTTTATTTTTT

TCTGTCCAGAAGAATTTCATAGAGCTTTACCAGGCTGTGCAAAGAAAAATTCTTCTCAGGCAACATTTGCTTTTAAAAATAATCATGAAGAGAAAAAGTT

GTTAACGCAAAAAGTTTTATTTTGTTTTTCTTGTCTTCCAAGATCCGATTTCCCCACCTCCCACTTGCCATCCAGCAGATGCCATCCTGTCATCTAAGCT

GGTCATTACTAATACACAAGGAGACTGTCTCCTGACAGCCAGCACTGTGCAATCACTCAGGAACCAGCGGATCTGCAAAGACCTACAATCAAACGCAAAT

CTCCATTTTCCTTTTACAAAGCATTCTACCCTCACTTCCAGTATAAACATATTAAAAGAATATAAAAATGTTGAAAATCATGTACTAATGAAGTCATTGT

ATATTAGATTGCAATAGAATGGAAAGACACATTTAGCTAGTAATGTACCTGGAAATCCTGAATGTCCTACGTGAGTATTAGATTTTGATAGCATGCTTTA

AAGACTGATGAATATAAAAGCAGAAGCTTCGAGTTTCCTGCTGCTTTCAAAACTGTGTCCTAGTTGAGTGATACAAATGATCGCAAGTTTTCTAAATCAT

TAAACTATTTGGTTGGTGGAGTGAGGCATGGTCTGGTATCCTCTGATTTGTAAAATAGCGATGGCAGTGAAGTTGTAACTGAAATTGAAGCTGATCTTCC

TTTCTGGTATGTTATCTATTGTGCCAGCCCTTGAGATTACTTGCAGAATGTGGCTATAAGTTTTAGTAGTTTATGGATCAGAGGGATATTTTTAAAATAT

GCTAATCGAAAGAACCTAGTAAATTAAATATTCCTAACAGCAAATAGAATGATTTTATGGTAACCATTAAAAAGAATAAGTCTTCCCCTGTCCCAGAGGT

CATTCTATAATTATCAAGATAGGATAAGAGTTAGGGTTACGATTCTGAGAGATGTCCCAAATTCATAAAGCAATAATAATAACCTTTATATTGGTTCCCT

CTTCCAAAGTTTAACTCTTGAGAAATGAATTCTTAGTCTTAATTGTACTTTGCTTATTCAGTACTTACAGTTTTACATGATTTTTACTCTAAGACTTTTG

GAAAGTGCCCTGCGCCCTCAGAAACAGTCGGACTATTAGTTCACAAATACTACAAGCTCTTGTATGGGGAAAAGAGCTTATTTTAAATAATTTGCTAAAC

TTTAGGAAATGATATATCAGTCTTAACAGGCATAAAGATCTCACCTAATGACTTGAGAAACTTTTGCTTAGTGCTTTTTTTCCCCTGTATAAATATTGTC

TAGAAGGAAAGTTAATATAGGAACAAGACTCCAAAATCCACGAAAATATGTTCCTAGTGAATATATCCTTTATCATTAATATTAGCCCATTATATTTTCA

TCTGTATTTGCCTTTTAAATTTATTTGCATCTATTAAAGATAATTAGGATTACTGAGTTTGTGTTTTTCTAATAAATCTGTTTCATCCTTTCAGTAGCAC

ATGCCAGAGGCTCACATTTGTGCTAAGTTTCATGTTTCAAGACAGTCTGTAGCCGTATTTACTGGTCATGCAAGTAGAGGAGATACACATCACCAGTGTT

TTTCTTAAGTGCATAAAGGACTTATCCTCGTCCTGGAAGTCTGTTGCTTTAAAAGCAAGTATCCATAAACATTATGGCCTTCCATTTAAAAAATCTCCAT

ACATTTTTTAGGATCCACTTGTGCATGTAGTTGAGACCACCGTCTCTTAAAATATAGCACTTTTCAATTCTCTCTAAAGAAATACTTATGTAATACTATC

ACACGTTGTAAATTTTCATGTAATAGTGTTTTCTGTGACTAAACTTCATTTTGATTGGCAGCTAAGACTTTTTTTCCTGTGGCTTTAATTTATCTAAGAG

GTCTTTGCATATAGATGAAATGTTTAATTTGCCTGGCGGACTATTTGCGTTTGTGTGGCCTTAGTTTGTTTATTGACATTAACAAGTGTTTTAAAAGGTT

TTTAATGGATAGTCTTAAATCTCAAATTTGTGTGAATAATAATTCTTTTAACACAGTGCTTTTTTGTAGCTGTCTGAGTGTGTTAAATTGTTAAGCTATT

TCTTTGTAAAGTAGGACAATGGAATGCATAGGTTTCTTTTTTTTCCTGTAAAGTATTTTTTTAATAAACAAAGTCTGATTTGTCCTTTACTGATGTTTCA

AAATG
Translation
MAAQVGAVRVVRAVAAQEEPDKEGKEKPHVGVSPRGVKRQRRASSGGSQEKRGRPSQDPPLAPPHRRRRSRQHPGPLPPTNAAPTVPGPVEPLLLPPPPP

PSLAPAGPTVAAPLPAPGTSALFTFSPLTVSAAGPKHKGHKERHKHHHHRGSDGDPGACVPGDLKHKDKQENGERSGGVPLIKAPKRE - UNI23977 

- ETADENGKTQRADDFVLKKIKKKKKKKHREDMRGRRLKMYNKEVQTVCAGLTRISKEILTQGQLNSTSGVNKESFRYLKDEQLCRLNLGMQEYRVPQG

VQTPFTTHQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAYYALAIVHGAAAYLPDFLDYFAFN

FPNTPVKMEILGKKDIETTTISNFHTQ VNRTYCCGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEESPFLK MTLPWGTLSSLQLQCRSQSDDGPIM

WVRPGEQMIPTADMPKSPFKRRR RSMNEIKNLQYLPRTSEPREVLFEDRTRAHADHVGQGFDWQSTAAVGVLKAVQFGEW WSDQPRITKDVICFHAED

FTDVVQRLQLDLHEPPVSQ CVQWVDEAKLNQMRREGIRYARIQLCDNDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQYHPVVETAQNTESNSNMDCGLE

VDSQCVRIKTESEERCTEMQLLTTASPSFPPPSELHLQDLKTQPLPVFKVESRLDSDQQHSLQAHPSTPV
Transcript ENSMUST00000051139
Sequence
CCTCCGGGCAAGATGAAGGAGGAACACTGGAAGTGGAGCGCCTGAACACACGGCGAGACTCTGAAAGCTATTAACATTGTTTGGGCGGTTAGGGCGGTTG

GCGGCAACTCGCCGGAGGGCGGCAGTTGCGTGGCACCCCGAAGCGTGCCTAGGCGCACGCTCCCCTCCGCTCCTCCACTCAGAGAGCAAAGTGGGGGCGG

AGGGGGAGGGGGAAGAACGCGAAGGGCGGTGGAACTACAACTCCCGCAAGGCCTTGCGCGTCCAGGGTGCTTTACAATAGAAGCTCGGTTGGCGAGGTCT

GCGGAGAGGTGTCGGAACTGCCGTTTCCGGCATGTTCAGGTCTACGAGAACGACCGATCAGTGGAGGGTGGGGGAGAGACTCCAATGCCCAGCGGGCCAT

GCGCGGGCAGCGCTTGCGCGAACCGCGGACGGGGGGGCGGTCGGGCCATTTAAATGTGTGTTTGTGGGTGAAATGGCTGCGCAGGTCGGAGCGGTTCGCG

TAGTACGGGCGGTGGCGGCGCAGGAGGAGCCGGACAAAGAAGGGAAGGAGAAACCCCATGTTGGGGTTTCGCCGCGGGGAGTGAAGCGGCAGCGCCGGGC

GAGCAGCGGGGGTTCTCAGGAGAAGCGGGGGCGGCCGAGCCAGGACCCCCCTCTCGCTCCCCCTCATCGGCGGCGTCGTAGCCGCCAACATCCCGGGCCG

CTGCCTCCAACGAATGCCGCCCCAACCGTCCCGGGCCCTGTTGAACCTCTGCTCCTGCCGCCTCCGCCGCCACCGTCGCTGGCACCCGCCGGGCCCACTG

TCGCTGCCCCGCTCCCGGCCCCGGGCACCTCGGCCCTCTTCACCTTCTCGCCTCTGACGGTGAGCGCGGCCGGGCCCAAGCATAAGGGCCACAAGGAGCG

GCACAAGCACCATCACCACCGCGGCTCCGATGGTGACCCCGGCGCCTGCGTTCCGGGCGATCTCAAGCACAAGGACAAGCAGGAAAACGGCGAAAGGAGC

GGAGGGGTGCCTCTGATCAAGGCCCCCAAGAGAG - UNI23977 - AAACAGCAGATGAAAATGGTAAAACCCAGAGAGCTGATGATTTTGTCTTGAA

GAAAATAAAGAAGAAAAAGAAAAAGAAACATCGAGAAGACATGAGAGGAAGACGCCTTAAAATGTACAATAAGGAAGTACAAACCGTCTGTGCTGGCCTG

ACCCGCATCAGCAAAGAAATTCTCACCCAAGGACAGCTAAATAGCACTTCAGGAGTTAATAAGGAGTCCTTCAGGTATTTGAAGGATGAACAGCTGTGCA

GATTAAATTTGGGCATGCAAGAATATCGGGTGCCCCAGGGAGTACAGACACCTTTTACAACGCACCAAGAACATTCTATTCGCAGAAATTTCTTAAAAAC

AGGTACTAAATTTAGCAACTTTATTCACGAAGAACACCAGTCCAATGGGGGTGCTCTTGTCCTTCATGCATACATGGACGAACTCTCATTTTTGTCTCCA

ATGGAGATGGAGAGATTTTCTGAGGAGTTTCTTGCTTTGACATTCAGTGAAAATGAGAAAAACGCTGCGTACTATGCGTTAGCAATAGTGCATGGAGCGG

CCGCTTATCTCCCAGACTTCTTGGACTACTTTGCTTTTAATTTTCCCAACACTCCAGTGAAAATGGAAATTTTGGGCAAGAAAGATATTGAAACAACCAC

CATTTCAAATTTTCATACTCAG GTCAACAGGACATATTGCTGTGGTACCTACCGAGCAGGTCCTATGCGGCAGATAAGTCTTGTTGGAGCAGTAGATGA

AGAAGTTGGTGATTATTTCCCAGAGTTCCTAGATATGCTAGAAGAATCACCATTTCTGAAA ATGACTTTGCCCTGGGGTACACTTTCCAGCCTCCAGCT

ACAATGTAGGTCTCAGAGCGATGACGGGCCTATAATGTGGGTGAGGCCAGGAGAACAGATGATCCCTACAGCAGATATGCCAAAGTCACCCTTCAAAAGA

CGACG ATCAATGAATGAAATTAAAAATCTCCAGTACCTACCTCGGACAAGTGAACCCCGAGAAGTCCTCTTTGAAGACAGGACCAGAGCTCATGCTGAT

CATGTAGGTCAGGGGTTTGACTGGCAAAGTACGGCTGCTGTTGGGGTTTTGAAGGCTGTACAATTCGGTGAATG GAGTGATCAGCCTCGCATAACCAAA

GATGTGATTTGTTTTCATGCTGAGGATTTTACTGATGTTGTACAGAGACTTCAGTTAGACCTTCATGAACCTCCAGTTTCTCAG TGTGTACAGTGGGTG

GATGAAGCAAAACTAAACCAAATGAGGCGAGAAGGCATTCGCTATGCTAGAATTCAGCTTTGCGACAATGATATCTACTTCATCCCTAGAAATGTCATTC

ATCAGTTCAAAACAGTGTCAGCAGTATGCAGCCTAGCCTGGCATATAAGGCTTAAACAATACCACCCTGTTGTGGAAACCGCTCAAAACACAGAGAGCAA

TTCCAACATGGATTGTGGTTTAGAAGTTGACTCCCAGTGTGTGAGAATAAAAACTGAATCTGAGGAAAGATGCACAGAGATGCAGCTTTTGACAACTGCT

TCACCGTCTTTCCCACCTCCATCAGAACTTCATCTACAGGATCTGAAGACTCAGCCTCTTCCAGTTTTCAAGGTGGAGAGCAGACTGGACTCTGACCAGC

AACACAGTCTGCAGGCACATCCAAGCACTCCTGTGTGACAT ATCCGATTTCCCCACCTCCCACTTGCCATCCAGCAGATGCCATCCTGTCATCTAAGCT

GGTCATTACTAATACACAAGGAGACTGTCTCCTGACAGCCAGCACTGTGCAATCACTCAGGAACCAGCGGATCTGCAAAGACCTACAATCAAACGCAAAT

CTCCATTTTCCTTTTACAAAGCATTCTACCCTCACTTCCAGTATAAACATATTAAAAGAATATAAAAATGTTGAAAATCATGTACTAATGAAGTCATTGT

ATATTAGATTGCAATAGAATGGAAAGACACATTTAGCTAGTAATGTACCTGGAAATCCTGAATGTCCTACGTGAGTATTAGATTTTGATAGCATGCTTTA

AAGACTGATGAATATAAAAGCAGAAGCTTCGAGTTTCCTGCTGCTTTCAAAACTGTGTCCTAGTTGAGTGATACAAATGATCGCAAGTTTTCTAAATCAT

TAAACTATTTGGTTGGTGGAGTGAGGCATGGTCTGGTATCCTCTGATTTGTAAAATAGCGATGGCAGTGAAGTTGTAACTGAAATTGAAGCTGATCTTCC

TTTCTGGTATGTTATCTATTGTGCCAGCCCTTGAGATTACTTGCAGAATGTGGCTATAAGTTTTAGTAGTTTATGGATCAGAGGGATATTTTTAAAATAT

GCTAATCGAAAGAACCTAGTAAATTAAATATTCCTAACAGCAAATAGAATGATTTTATGGTAACCATTAAAAAGAATAAGTCTTCCCCTGTCCCAGAGGT

CATTCTATAATTATCAAGATAGGATAAGAGTTAGGGTTACGATTCTGAGAGATGTCCCAAATTCATAAAGCAATAATAATAACCTTTATATTGGTTCCCT

CTTCCAAAGTTTAACTCTTGAGAAATGAATTCTTAGTCTTAATTGTACTTTGCTTATTCAGTACTTACAGTTTTACATGATTTTTACTCTAAGACTTTTG

GAAAGTGCCCTGCGCCCTCAGAAACAGTCGGACTATTAGTTCACAAATACTACAAGCTCTTGTATGGGGAAAAGAGCTTATTTTAAATAATTTGCTAAAC

TTTAGGAAATGATATATCAGTCTTAACAGGCATAAAGATCTCACCTAATGACTTGAGAAACTTTTGCTTAGTGCTTTTTTTCCCCTGTATAAATATTGTC

TAGAAGGAAAGTTAATATAGGAACAAGACTCCAAAATCCACGAAAATATGTTCCTAGTGAATATATCCTTTATCATTAATATTAGCCCATTATATTTTCA

TCTGTATTTGCCTTTTAAATTTATTTGCATCTATTAAAGATAATTAGGATTACTGAGTTTGTGTTTTTCTAATAAATCTGTTTCATCCTTTCAGTAGCAC

ATGCCAGAGGCTCACATTTGTGCTAAGTTTCATGTTTCAAGACAGTCTGTAGCCGTATTTACTGGTCATGCAAGTAGAGGAGATACACATCACCAGTGTT

TTTCTTAAGTGCATAAAGGACTTATCCTCGTCCTGGAAGTCTGTTGCTTTAAAAGCAAGTATCCATAAACATTATGGCCTTCCATTTAAAAAATCTCCAT

ACATTTTTTAGGATCCACTTGTGCATGTAGTTGAGACCACCGTCTCTTAAAATATAGCACTTTTCAATTCTCTCTAAAGAAATACTTATGTAATACTATC

ACACGTTGTAAATTTTCATGTAATAGTGTTTTCTGTGACTAAACTTCATTTTGATTGGCAGCTAAGACTTTTTTTCCTGTGGCTTTAATTTATCTAAGAG

GTCTTTGCATATAGATGAAATGTTTAATTTGCCTGGCGGACTATTTGCGTTTGTGTGGCCTTAGTTTGTTTATTGACATTAACAAGTGTTTTAAAAGGTT

TTTAATGGATAGTCTTAAATCTCAAATTTGTGTGAATAATAATTCTTTTAACACAGTGCTTTTTTGTAGCTGTCTGAGTGTGTTAAATTGTTAAGCTATT

TCTTTGTAAAGTAGGACAATGGAATGCATAGGTTTCTTTTTTTTCCTGTAAAGTATTTTTTTAATAAACAAAGTCTGATTTG
Translation
MAAQVGAVRVVRAVAAQEEPDKEGKEKPHVGVSPRGVKRQRRASSGGSQEKRGRPSQDPPLAPPHRRRRSRQHPGPLPPTNAAPTVPGPVEPLLLPPPPP

PSLAPAGPTVAAPLPAPGTSALFTFSPLTVSAAGPKHKGHKERHKHHHHRGSDGDPGACVPGDLKHKDKQENGERSGGVPLIKAPKRE - UNI23977 

- ETADENGKTQRADDFVLKKIKKKKKKKHREDMRGRRLKMYNKEVQTVCAGLTRISKEILTQGQLNSTSGVNKESFRYLKDEQLCRLNLGMQEYRVPQG

VQTPFTTHQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLALTFSENEKNAAYYALAIVHGAAAYLPDFLDYFAFN

FPNTPVKMEILGKKDIETTTISNFHTQ VNRTYCCGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEESPFLK MTLPWGTLSSLQLQCRSQSDDGPIM

WVRPGEQMIPTADMPKSPFKRRR RSMNEIKNLQYLPRTSEPREVLFEDRTRAHADHVGQGFDWQSTAAVGVLKAVQFGEW WSDQPRITKDVICFHAED

FTDVVQRLQLDLHEPPVSQ CVQWVDEAKLNQMRREGIRYARIQLCDNDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQYHPVVETAQNTESNSNMDCGLE

VDSQCVRIKTESEERCTEMQLLTTASPSFPPPSELHLQDLKTQPLPVFKVESRLDSDQQHSLQAHPSTPV 
Transcript ENSMUST00000068879
Sequence
CCTCCGGGCAAGATGAAGGAGGAACACTGGAAGTGGAGCGCCTGAACACACGGCGAGACTCTGAAAGCTATTAACATTGTTTGGGCGGTTAGGGCGGTTG

GCGGCAACTCGCCGGAGGGCGGCAGTTGCGTGGCACCCCGAAGCGTGCCTAGGCGCACGCTCCCCTCCGCTCCTCCACTCAGAGAGCAAAGTGGGGGCGG

AGGGGGAGGGGGAAGAACGCGAAGGGCGGTGGAACTACAACTCCCGCAAGGCCTTGCGCGTCCAGGGTGCTTTACAATAGAAGCTCGGTTGGCGAGGTCT

GCGGAGAGGTGTCGGAACTGCCGTTTCCGGCATGTTCAGGTCTACGAGAACGACCGATCAGTGGAGGGTGGGGGAGAGACTCCAATGCCCAGCGGGCCAT

GCGCGGGCAGCGCTTGCGCGAACCGCGGACGGGGGGGCGGTCGGGCCATTTAAATGTGTGTTTGTGGGTGAAATGGCTGCGCAGGTCGGAGCGGTTCGCG

TAGTACGGGCGGTGGCGGCGCAGGAGGAGCCGGACAAAGAAGGGAAGGAGAAACCCCATGTTGGGGTTTCGCCGCGGGGAGTGAAGCGGCAGCGCCGGGC

GAGCAGCGGGGGTTCTCAGGAGAAGCGGGGGCGGCCGAGCCAGGACCCCCCTCTCGCTCCCCCTCATCGGCGGCGTCGTAGCCGCCAACATCCCGGGCCG

CTGCCTCCAACGAATGCCGCCCCAACCGTCCCGGGCCCTGTTGAACCTCTGCTCCTGCCGCCTCCGCCGCCACCGTCGCTGGCACCCGCCGGGCCCACTG

TCGCTGCCCCGCTCCCGGCCCCGGGCACCTCGGCCCTCTTCACCTTCTCGCCTCTGACGGTGAGCGCGGCCGGGCCCAAGCATAAGGGCCACAAGGAGCG

GCACAAGCACCATCACCACCGCGGCTCCGATGGTGACCCCGGCGCCTGCGTTCCGGGCGATCTCAAGCACAAGGACAAGCAGGAAAACGGCGAAAGGAGC

GGAGGGGTGCCTCTGATCAAGGCCCCCAAGAGAG - UNI23977 - AAACAGCAGATGAAAATGGTAAAACCCAGAGAGCTGATGATTTTGTCTTGAA

GAAAATAAAGAAGAAAAAGAAAAAGAAACATCGAGAAGACATGAGAGGAAGACGCCTTAAAATGTACAATAAGGAAGTACAAACCGTCTGTGCTGGCCTG

ACCCGCATCAGCAAAGAAATTCTCACCCAAGGACAGCTAAATAGCACTTCAGGAGTTAATAAGGAGTCCTTCAGGTATTTGAAGGATGAACAGCTGTGCA

GATTAAATTTGGGCATGCAAGAATATCGGGTGCCCCAGGGAGTACAGACACCTTTTACAACGCACCAAGAACATTCTATTCGCAGAAATTTCTTAAAAAC

AGGTACTAAATTTAGCAACTTTATTCACGAAGAACACCAGTCCAATGGGGGTGCTCTTGTCCTTCATGCATACATGGACGAACTCTCATTTTTGTCTCCA

ATGGAGATGGAGAGATTTTCTGAGGAGTTTCTTGCTTTGACATTCAGTGAAAATGAGAAAAACGCTGCGTACTATGCGTTAGCAATAGTGCATGGAGCGG

CCGCTTATCTCCCAGACTTCTTGGACTACTTTGCTTTTAATTTTCCCAACACTCCAGTGAAAATGGAAATTTTGGGCAAGAAAGATATTGAAACAACCAC

CATTTCAAATTTTCATACTCAG GTCAACAGGACATATTGCTGTGGTACCTACCGAGCAGGTCCTATGCGGCAGATAAGTCTTGTTGGAGCAGTAGATGA

AGAAGTTGGTGATTATTTCCCAGAGTTCCTAGATATGCTAGAAGAATCACCATTTCTGAAA ATGACTTTGCCCTGGGGTACACTTTCCAGCCTCCAGCT

ACAATGTAGGTCTCAGAGCGATGACGGGCCTATAATGTGGGTGAGGCCAGGAGAACAGATGATCCCTACAGCAGATATGCCAAAGTCACCCTTCAAAAGA

CGACG ATCAATGAATGAAATTAAAAATCTCCAGTACCTACCTCGGACAAGTGAACCCCGAGAAGTCCTCTTTGAAGACAGGACCAGAGCTCATGCTGAT

CATGTAGGTCAGGGGTTTGACTGGCAAAGTACGGCTGCTGTTGGGGTTTTGAAGGCTGTACAATTCGGTGAATG GAGTGATCAGCCTCGCATAACCAAA

GATGTGATTTGTTTTCATGCTGAGGATTTTACTGATGTTGTACAGAGACTTCAGTTAGACCTTCATGAACCTCCAGTTTCTCAG TGTGTACAGTGGGTG

GATGAAGCAAAACTAAACCAAATGAGGCGAGAAGGCATTCGCTATGCTAGAATTCAGCTTTGCGACAATGATATCTACTTCATCCCTAGAAATGTCATTC

ATCAGTTCAAAACAGTGTCAGCAGTATGCAGCCTAGCCTGGCATATAAGGCTTAAACAATACCACCCTGTTGTGGAAACCGCTCAAAACACAGAGAGCAA

TTCCAACATGGATTGTGGTTTAGAAGTTGACTCCCAGTGTGTGAGAATAAAAACTGAATCTGAGGAAAGATGCACAGAGATGCAGCTTTTGACAACTGCT

TCACCGTCTTTCCCACCTCCATCAGAACTTCATCTACAGGATCTGAAGACTCAGCCTCTTCCAGTTTTCAAGGTGGAGAGCAGACTGGACTCTGACCAGC

AACACAGTCTGCAGGCACATCCAAGCACTCCTGTGTGACATGTACATATTCAAACACATTTTTTAACTTTTTTAAATTTTGATGTGAAGTTATAGTTTTA

TAACTGGCTTAAGTTAAGTTTTATTGGAGAAATCTTGCCTATAATTCTATAAAGAGAAATGACATTCCACAAATGTCAAGCATATCTTTTTTACACAGAT

TATGCAAAGCTAAGAGTTGTATCGTTAGTACAGTATGTAATAGTGGGTCTGCTGCTACTTTCTGTTTTAAGGTGTGAGGTTACAATTCAATCTCTTCTTC

AAATCAAAAAAAGAATTCTCTGGAATAGCAGGTTCTTACTTGGTATTTACTTCCCTTGATTTTATCTTTCCTTGTCTCTTGCCATATTTGCTTTATGTGG

TAGAAAGCAGATTTATGGTTTAATACTTGTGTCTTCATGGCACCTCGTTAGTTTCCACAGTAAAATGATATTTGGTTGCAGGAAAGGCTCCTGCATCTGG

TACATGGACAAGTGAGTTGTTTAGTTCTAACCACAAAGAAGACATGGTCTCTAAAGAAAACTCTCTGGCTTCTGGTTTTCAGCAAAAGAGGAAACACAGC

ATTCTCTGATCCAGGCCGTCTTTTTGTGTCTGTTATTTAAAACCCAGTGGCTACTTCAATTAAACAAACCTCTAAAGATGACAAACAAAAATCTAAACAT

TGGCTATACATGATCCATGGTTCATTGATCTTTTCTAGGATATTTACTAACTATACAGGCTGTTTTGAGGAGGAGAGATAATGCTGACCTGTTGTGCTTC

CTAGTATCCTCATATCAAAGTTAGAGAACTGCACCAGTCTTACTGATGAGGGCTGCCACAGCTGAGCATCAAACTAAGGAGAAACTATTCTTGTGACTTG

GCATCTACTTTTGAAAACACTTTACAATTTTATCAGGCTAATAATACCTGGGTTTGTTCATTGTTATTCAGTGTTGCTATTTTCTAATAGCAGGCATTAG

ACTTCCATCCTAGTTTCAGGTAGGCTGAAACTTAGTGTCTGGATATTTACTTTGTTTTCCCTTTTTCAAACAGACCTCCTTCATCCAAGTAGTGTGGCTC

TTATTTTGGAATGTTCATGTGCTATGCATTATCCTTTCTCTAGTTATCAACTTGGTAGGCCTTTTGTTTACTAAAGGAAGAGTACTCTCCACACCTGAGA

CCAGATTCTTGTATCTACCTGGTTACAGTGCAATTTGATTTTTTTTTCCTGGATGGTGAGATTTGAGTTATTTGCATTAACATAGGCGAAAGAAAAAGAT

GCTGCTTTGTTATGTCTGTCACCATGGAAACTTCGCTGCATCTTTGGAAATATCAAATATGAATTTTCTCTAAAATATTCTGAAATAGGTTAAATCTTAT

ATAAATATTACTTTGTGCAATATTGTTGTGTAGTTAAATGCATATTAGCAAAGTATAGAGGTCACTGTGTAAACCGATAGAAAAGTAACCATCAGCAAAT

ACTACAGTGATTAGTTAGAATCTGTATTATTCCTTATATATATGTATATGTGTGTATTCTCTGTTACAAAGGATGAAGACAAATAAATAGGGAAACACTT

CAATGTAAACCATTTATGAATTGGAAGTGATGTTGCTTTTAGTTATCTTTGTAAATAAGGTAATTAGAATGGTATGAAAGGTAATGTGATTATTACAGGG

GTGTTTTTAAATCCTGTGTATAAATTCTAGGGTAAATTCTAGTTTATCAAACTAGTTTTTAAGGGACCTTTGAGGGTATTTTTTGTTGTTATTTTGTGGA

GAAAAGGGGCATATCACAAAATGAATGGGTTTGGGTTATTTCTTATTTTTATTTTTTTCTGTCCAGAAGAATTTCATAGAGCTTTACCAGGCTGTGCAAA

GAAAAATTCTTCTCAGGCAACATTTGCTTTTAAAAATAATCATGAAGAGAAAAAGTTGTTAACGCAAAAAGTTTTATTTTGTTTTTCTTGTCTTCCAAGA

TCCGATTTCCCCACCTCCCACTTGCCATCCAGCAGATGCCATCCTGTCATCTAAGCTGGTCATTACTAATACACAAGGAGACTGTCTCCTGACAGCCAGC

ACTGTGCAATCACTCAGGAACCAGCGGATCTGCAAAGACCTACAATCAAACGCAAATCTCCATTTTCCTTTTACAAAGCATTCTACCCTCACTTCCAGTA

TAAACATATTAAAAGAATATAAAAATGTTGAAAATCATGTACTAATGAAGTCATTGTATATTAGATTGCAATAGAATGGAAAGACACATTTAGCTAGTAA

TGTACCTGGAAATCCTGAATGTCCTACGTGAGTATTAGATTTTGATAGCATGCTTTAAAGACTGATGAATATAAAAGCAGAAGCTTCGAGTTTCCTGCTG

CTTTCAAAACTGTGTCCTAGTTGAGTGATACAAATGATCGCAAGTTTTCTAAATCATTAAACTATTTGGTTGGTGGAGTGAGGCATGGTCTGGTATCCTC

TGATTTGTAAAATAGCGATGGCAGTGAAGTTGTAACTGAAATTGAAGCTGATCTTCCTTTCTGGTATGTTATCTATTGTGCCAGCCCTTGAGATTACTTG

CAGAATGTGGCTATAAGTTTTAGTAGTTTATGGATCAGAGGGATATTTTTAAAATATGCTAATCGAAAGAACCTAGTAAATTAAATATTCCTAACAGCAA

ATAGAATGATTTTATGGTAACCATTAAAAAGAATAAGTCTTCCCCTGTCCCAGAGGTCATTCTATAATTATCAAGATAGGATAAGAGTTAGGGTTACGAT

TCTGAGAGATGTCCCAAATTCATAAAGCAATAATAATAACCTTTATATTGGTTCCCTCTTCCAAAGTTTAACTCTTGAGAAATGAATTCTTAGTCTTAAT

TGTACTTTGCTTATTCAGTACTTACAGTTTTACATGATTTTTACTCTAAGACTTTTGGAAAGTGCCCTGCGCCCTCAGAAACAGTCGGACTATTAGTTCA

CAAATACTACAAGCTCTTGTATGGGGAAAAGAGCTTATTTTAAATAATTTGCTAAACTTTAGGAAATGATATATCAGTCTTAACAGGCATAAAGATCTCA

CCTAATGACTTGAGAAACTTTTGCTTAGTGCTTTTTTTCCCCTGTATAAATATTGTCTAGAAGGAAAGTTAATATAGGAACAAGACTCCAAAATCCACGA

AAATATGTTCCTAGTGAATATATCCTTTATCATTAATATTAGCCCATTATATTTTCATCTGTATTTGCCTTTTAAATTTATTTGCATCTATTAAAGATAA

TTAGGATTACTGAGTTTGTGTTTTTCTAATAAATCTGTTTCATCCTTTCAGTAGCACATGCCAGAGGCTCACATTTGTGCTAAGTTTCATGTTTCAAGAC

AGTCTGTAGCCGTATTTACTGGTCATGCAAGTAGAGGAGATACACATCACCAGTGTTTTTCTTAAGTGCATAAAGGACTTATCCTCGTCCTGGAAGTCTG

TTGCTTTAAAAGCAAGTATCCATAAACATTATGGCCTTCCATTTAAAAAATCTCCATACATTTTTTAGGATCCACTTGTGCATGTAGTTGAGACCACCGT

CTCTTAAAATATAGCACTTTTCAATTCTCTCTAAAGAAATACTTATGTAATACTATCACACGTTGTAAATTTTCATGTAATAGTGTTTTCTGTGACTAAA

CTTCATTTTGATTGGCAGCTAAGACTTTTTTTCCTGTGGCTTTAATTTATCTAAGAGGTCTTTGCATATAGATGAAATGTTTAATTTGCCTGGCGGACTA

TTTGCGTTTGTGTGGCCTTAGTTTGTTTATTGACATTAACAAGTGTTTTAAAAGGTTTTTAATGGATAGTCTTAAATCTCAAATTTGTGTGAATAATAAT

TCTTTTAACACAGTGCTTTTTTGTAGCTGTCTGAGTGTGTTAAATTGTTAAGCTATTTCTTTGTAAAGTAGGACAATGGAATGCATAGGTTTCTTTTTTT

TCCTGTAAAGTATTTTTTTAATAAACAAAGTCTGATTTGTCCTTTA
Translation
MFRSTRTTDQWRVGERLQCPAGHARAALARTADGGAVGPFKCVFVGEMAAQVGAVRVVRAVAAQEEPDKEGKEKPHVGVSPRGVKRQRRASSGGSQEKRG

RPSQDPPLAPPHRRRRSRQHPGPLPPTNAAPTVPGPVEPLLLPPPPPPSLAPAGPTVAAPLPAPGTSALFTFSPLTVSAAGPKHKGHKERHKHHHHRGSD

GDPGACVPGDLKHKDKQENGERSGGVPLIKAPKRE - UNI23977 - ETADENGKTQRADDFVLKKIKKKKKKKHREDMRGRRLKMYNKEVQTVCAGL

TRISKEILTQGQLNSTSGVNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFTTHQEHSIRRNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSP

MEMERFSEEFLALTFSENEKNAAYYALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILGKKDIETTTISNFHTQ VNRTYCCGTYRAGPMRQISLVGAVD

EEVGDYFPEFLDMLEESPFLK MTLPWGTLSSLQLQCRSQSDDGPIMWVRPGEQMIPTADMPKSPFKRRR RSMNEIKNLQYLPRTSEPREVLFEDRTRA

HADHVGQGFDWQSTAAVGVLKAVQFGEW WSDQPRITKDVICFHAEDFTDVVQRLQLDLHEPPVSQ CVQWVDEAKLNQMRREGIRYARIQLCDNDIYFI

PRNVIHQFKTVSAVCSLAWHIRLKQYHPVVETAQNTESNSNMDCGLEVDSQCVRIKTESEERCTEMQLLTTASPSFPPPSELHLQDLKTQPLPVFKVESR

LDSDQQHSLQAHPSTPV

For any suggestions or comments, please send an email to unitrap@crg.es