Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044117 (2900011O08Rik)
Chromosomal location
Chr 16: 13986721 - 14101593 (+)
Description
RIKEN cDNA 2900011O08 gene Gene [Source:MGI Symbol;Acc:MGI:1914504]
RefSeq_dna
NM_144518 
RefSeq_peptide
NP_653101.1 
UniGene
Mm.216217 Mm.403267 
MGI
MGI:1914504 
Uniprot/SWISSPROT
Q8R1Y2 
Human Ortholog
ENSG00000166780 (C16orf45)
Omim not available
UniTrap UNI14552
Vector Insertion
Chr 16: 13986987 - 14049475
Public Clones (sanger) CMHD-GT_474F8-3 (cmhd) FHCRC-GT-S6-5D1 (fhcrc) IST12173F12HMR1 (tigm)
IST12174G12 (tigm) IST12174A11 (tigm) IST13012E3 (tigm) IST14912A9 (tigm)
IST12171B7 (tigm) IST12176A6 (tigm) IST11047G5 (tigm) IST15086C6 (tigm)
IST12175B1 (tigm) IST12538B12 (tigm) IST12175G2HMR1 (tigm) IST14858D9 (tigm)
IST12173F8 (tigm) IST12323F7 (tigm) IST14793C11 (tigm) IST10922E1 (tigm)
IST12176H4HMR1 (tigm) IST10353E1 (tigm) IST13066F12 (tigm) IST12171C12 (tigm)
IST10937E8 (tigm) IST11464C12 (tigm) IST14727G5 (tigm) IST12841A1 (tigm)
IST10704C10 (tigm) IST12172H11 (tigm) IST12174H2HMR1 (tigm) IST15102B3 (tigm)
IST12125G1 (tigm) IST14751H9 (tigm) IST12173D12HMR1 (tigm) IST12553A11 (tigm)
IST14968E1 (tigm) IST12286A12 (tigm) IST13608C3 (tigm) IST12174H9 (tigm)
IST10132B1 (tigm) IST10386C6 (tigm) IST11215H12 (tigm) IST12125H1 (tigm)
Private Clones OST111025 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20299
Vector Insertion
Chr 16: 14049600 - 14089038
Public Clones not available
Private Clones OST367866 (lexicon) OST357105 (lexicon) OST352254 (lexicon) OST300487 (lexicon)
OST187058 (lexicon) OST185744 (lexicon) OST142019 (lexicon) OST121565 (lexicon)
OST109489 (lexicon) OST62656 (lexicon) OST47184 (lexicon) OST47178 (lexicon)
OST46190 (lexicon) OST44590 (lexicon) OST38860 (lexicon) OST38859 (lexicon)
OST32853 (lexicon)
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118412
Sequence
TTGAAGAGATGGAGCAGCTTCCTCAGCAACGCCGGGCCCATTAAAACACTGCCGATCTGAGCTGCCTTCCTCCCCGCAGCCTTCAGCAGGGATGGAGTGA

ACCAGACCCCTGGACCTGCCCGCGGGGAACAGCAATGGAGTTAAAGCAATCTCTGTCTGTTCATCTGGAAGCCGAGAAGCCTCTCAGGCGTTATGGGGCG

GTGGAGGAGACAGCATGGAAAGCGGAGGGACTGGGAA - UNI14552 - GCCAGCTAGACATCATCTCCATGGCTGAGACCAGCATGATGCCAGAGGA

GATCGAGCTGGAGATGGCGAAAATCCAGCGTCTCCGTGAAGTCCTGGTCCGTCGAGAGTCAGAACTCAGGTTCAT - UNI20299 - GATGGATGACA

TTCAGCTCTGCAAGGACATCATGGACCTGAAGCAGGAGCTGCAGAACTTGGTCGCCATCCCAG GGAACAGGAAGAAGACAAGGAAATGGCTGATTTCCT

GAGAATCAAGTTAAAACCTCTAGACAAAGTAACCAAGACTTCAGCCA GCTCCCGGGCAGAGAAGAAGGCAGAGCCCCCACCTAGCAAGCCAACAGTGGC

CAAGACAGGGCTGGCACTCATCAAGGATTGCTGTGGGACCACCCAGTGCAACATCATGTAGCCCCTATGTGGGTGCCCCAGAGCTATGGGGACCCTTCCT

CCCACCCTCTTGTCCTCATAGCCCCCATTTCACAGGGGTACAAGAGCTTTCCAAGGCAGAAGGGATTGACAGCAAGCCCATGACTGCTATCAGGGGCTAT

GGGTATGGCAGGTGGGCCCAGTCTGTACAGCGTGTAGCAATAGAGAGCCCCTCACTGTCGCATGACCCTCCCCAGAGCATGCCCAACCCAGGAGTCTGTC

TTATCATTTATCTAACCACCAAGAAAGCCCCTCCCTTAAAACAATAGACCTTCACTTTTCTCTAGGTGTATCTAACCTACCATG
Translation
MELKQSLSVHLEAEKPLRRYGAVEETAWKAEGLGS - UNI14552 - SQLDIISMAETSMMPEEIELEMAKIQRLREVLVRRESELRFM - UNI202

99 - MMDDIQLCKDIMDLKQELQNLVAIPG GNRKKTRKWLIS 
Transcript ENSMUST00000056521
Sequence
ACCAGTTGGGAGCTTTCAGGTGCTGGAGATTGAAGAGATGGAGCAGCTTCCTCAGCAACGCCGGGCCCATTAAAACACTGCCGATCTGAGCTGCCTTCCT

CCCCGCAGCCTTCAGCAGGGATGGAGTGAACCAGACCCCTGGACCTGCCCGCGGGGAACAGCAATGGAGTTAAAGCAATCTCTGTCTGTTCATCTGGAAG

CCGAGAAGCCTCTCAGGCGTTATGGGGCGGTGGAGGAGACAGCATGGAAAGCGGAGGGACTGGGAA - UNI14552 - GCCAGCTAGACATCATCTCC

ATGGCTGAGACCAGCATGATGCCAGAGGAGATCGAGCTGGAGATGGCGAAAATCCAGCGTCTCCGTGAAGTCCTGGTCCGTCGAGAGTCAGAACTCAGGT

TCAT - UNI20299 - GATGGATGACATTCAGCTCTGCAAGGACATCATGGACCTGAAGCAGGAGCTGCAGAACTTGGTCGCCATCCCAG AAAAAGA

AAAAACCAAGCTGCAGAAGCAGAGAGAGGATGAGCTCATCCAGAAGATCCACAGACTGGTACAGAAGAGAGACTTCCTGGTGGATGATGCCGAGGTGGAA

CGCTTAAG GGAACAGGAAGAAGACAAGGAAATGGCTGATTTCCTGAGAATCAAGTTAAAACCTCTAGACAAAGTAACCAAGACTTCAGCCA GCTCCCG

GGCAGAGAAGAAGGCAGAGCCCCCACCTAGCAAGCCAACAGTGGCCAAGACAGGGCTGGCACTCATCAAGGATTGCTGTGGGACCACCCAGTGCAACATC

ATGTAGCCCCTATGTGGGTGCCCCAGAGCTATGGGGACCCTTCCTCCCACCCTCTTGTCCTCATAGCCCCCATTTCACAGGGGTACAAGAGCTTTCCAAG

GCAGAAGGGATTGACAGCAAGCCCATGACTGCTATCAGGGGCTATGGGTATGGCAGGTGGGCCCAGTCTGTACAGCGTGTAGCAATAGAGAGCCCCTCAC

TGTCGCATGACCCTCCCCAGAGCATGCCCAACCCAGGAGTCTGTCTTATCATTTATCTAACCACCAAGAAAGCCCCTCCCTTAAAACAATAGACCTTCAC

TTTTCTCTAGGTGTATCTAACCTACCATGCAAACGAACTGGGCAAGGGCATAGCCCCAGGTGTGTATAGCTGTGAATTTCAATAATCTAGCACAGTGTTG

GTCCCATTCCCCACCTACCCTCCCAGCTTTGCTGTCAGATACAAGTCCCGTTCCCTGTTTGCCCTCTCCCAGGGACTGTAGCTTGGAGGGTTCCACACAG

CCCACACACCTCTTAGGCTCCATTGTAATCACTTCCCTAAAGACACTGGCCTGTCTATGAAAGCTGAGTGTGTGTGGTGTTGGGTTTACACCTCCTGCTC

CATCCCAGCCTGGTGTGTATCTATCTGCCAGACTCCAGGCTCTTCCTTGATTTGCCATGCCCAGCCCACAGTGGAACAGAGTAGGGAACTGTGACCAAAA

GCAGATCCAGTGCTTGGACCAGGTAGCAGAGAACTGCAGGGACCAATATCAAGACCAGAGTGAATGAGAAGGGGACCCAGAAAAGATGCCAACCCACATC

CTCTTCACCCAGGGCTGCTGCAAATGAGTACATACAAGTGGGAAGGTCACACTGCTGGCCCAACACACACTGACAGGAAGCCTGACCCAACTATGTCCCA

TTGTCTGGTGGCGTGTTTGAACCAGCCCCACAATTCGTCTTGTGTAACTTGATGTACATTTTAAATGGCCAGCCCAGCACAGCCTGTGTGAACTCTGTGC

GTGTATGTGTGTTATGACTGGCCTAAGTACTTAGCACCAGTCAAGATTTGCTGATGTGCAAACTATCCATCAGAGAAAATAAAAATGAAAAACACACATA

ACATCTTATATGTTCTTACCTTTTTAAATTATAGATATAACTCATATACTTAGAAAATCATTTTTAAAGTACAGAAAGTATATAAAAATTTTATCTACTC

ACAATTTTCCTTGTGACCTCTGATATTTTGACCTTTGTCCTCAAGTCTTCTCATAAATTTCTTTTGTCATGATTTGCATCATATTGAAACATTTTATACC

CAGCTTTCTTTTCAGTTATTATTATACCAAGTAGGCTCCTCCTCCATCATTCAAAGTTCTTTGTTAACATTAAACATGCTTCATATTTATAATGGTTGCT

TAGTACTCCATCTTGTGGATATACTGTTGTCTATTTTACCATTGCCTCAATACTGGACATTTAGACCATCCCTACGTTTTCCCATATCATAAATGAGGTC

ATGACCAACATCCTGAGGAGCTAAATCTTCACCTGAATTTGTCTTTGTCTTTTTCTTTTTTTAAAGATAAACTAGAAGTAAAATTATTGGTCATTAATGA

G
Translation
MELKQSLSVHLEAEKPLRRYGAVEETAWKAEGLGS - UNI14552 - SQLDIISMAETSMMPEEIELEMAKIQRLREVLVRRESELRFM - UNI202

99 - MMDDIQLCKDIMDLKQELQNLVAIPE EKEKTKLQKQREDELIQKIHRLVQKRDFLVDDAEVERLR REQEEDKEMADFLRIKLKPLDKVTKTSA

S SSRAEKKAEPPPSKPTVAKTGLALIKDCCGTTQCNIM

For any suggestions or comments, please send an email to unitrap@crg.es