Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044149 (Nkrf)
Chromosomal location
Chr X: 34427539 - 34442894 (-)
Description
NF-kappaB repressing factor Gene [Source:MGI (curated);Acc:Nkrf-001]
RefSeq_dna
NM_029891 
RefSeq_peptide
NP_084167.2 
UniGene
Mm.21649 
MGI
MGI:1924536 
Uniprot/SWISSPROT
Q8BY02 
Uniprot/SPTREMBL
A2A3V7 Q4VBF1 
Human Ortholog
ENSG00000186416 (NKRF)
Omim not available
UniTrap UNI30867
Vector Insertion
Chr X: 34431619 - 34442895
Public Clones IST11991E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000057093
Sequence
GAGCCAGTGCTGGAGCAGTGGCGCTATAGCCACGAAAGTGACTGGCAGTGGGCTCTGCGGCGGAGCTTCATCTGCCGGCACCTGCACAGCTATCCCGGGG

CTGCCCTGGACCAGCTCCTCGCGCTCTCCGCCGCCTGGACAAACCACGTTTTCCTGGGCTGCAG - UNI30867 - GTATAGCCCACACTTGATGGAA

AAAATTCTTCACATGGCTGAAGGTATTGATATTGGGGAGATGCCGTCATATGATCTAATGCTGCCCAAACCTTCCAAAGGCCAAAAACGCTACCTTTCAA

CCTACGATG - UNI30867 - GTCAGAATCCTCCTAAAAAGCAAGCCGGTTCCAAATTCCATGTGAGAGCTCGTTTTGAGCCTGTACATTTTGTAGCT

AGTAGTTCAAAAGCTGAAAGACAGGAAGATCCGTATGGCCCTCAAACAAAAGACGTAAATGGACGAACACATTTTGCCAGCATGCCAAGAAACTTCTACC

AAGATTATACTCAAGACTCTTTCAGTATCCAGGATGGAAATTCTCAATATTGTAATTCATCAGGATTTATTTTCACAAAAGACCAGCCTGTAGCAACCAA

CATGTATTTTGACAGTGGGAACCCTGCCCCAAGCAGCACATCCCAGCAGGCAAACTGTCAGCCAGCTCCCGAGCCTCCTCCTTCACAGATGTACCCTGAG

TCCTTGGTTGCCGAGAAGCAGTATTTTATTGAAAAGTTAACAGCAACTATCTGGAAGAACCTTTCTAATCCAGAGATGACTTCTGGATCTGATAAGATTA

ATTATACCTATATGCTAACTCGTTGTATTCAGGCATGTAAGACAAATCCTGAGTATATATATGCTCCTTTAAAAGAAATTCCTCCTGCTGACATCCCCAA

AAATAAAAAACTTCTCACGGATGGTTATGCTTGTGAAGTTAGATGCCAAAATATCTACCTAACTACAGGTTATGCAGGTAGCAAGAATGGGTCCAGAGAT

CGAGCTACTGAGCTAGCTGTAAAACTCTTGCAGAAGAGGATTGAGGTTAGAGTTGTCCGACGGAAATTCAAGCACATAATCGGAGAGGACCTTGTGGTGT

GTCAGATTGGTATGCTTTCATATGAATTTCCCCCAGCTCTGAAACCACCAGAAGACCTGGTAGTACTGGGAAAGGATGCTTCTGGGCAGCCTATTTTTAA

TAGTTCTGCCAAACACTGGACCAATTTTGTCATTACAGAAAATGCAAATGATGCAATTGGCATCCTTAACAATTCCGCCTCATTCAACAAAATGTCAATT

GAGTACAAATACGAGATGATGCCAAACCGCACATGGCGGTGTCGAGTATTCCTGCAAGATCACTGCTTAGCTGAAGGTTATGGAACCAAGAAAACAAGCA

AACATGCAGCTGCTGATGAGGCTTTGAAAGTTCTTCAAAAAACACAACCCACTTATCCATCTGTCAAAAGTTCCCAGTGTCACTCAGGCTCTTCACCCAA

AGGATCCGGAAAGAAGAAAGATATCAAAGATCTTGTAGTTTATGAGAATTCTTCCAATCCTGTGTGCACATTGAATGATACGGCTCAGTTTAACCGAATG

ACGGTTGAATATGTCTATGAAAGGATGACAGGTCTCCGCTGGAAATGCAAGGTGATTCTAGAGAGCGAAGTCATTGCAGAAGCAGTTGGTGTGAAGAAAA

GTGTCAAATACGAAGCTGCTGGAGAAGCTGTAAAGACCCTCAAAAAGACCCAGCCGACTGTCATTAACAACTTGAAGAAAGGGACTGTTGAAGATGTGAT

TTCAAGAAATGAAATCCAGGGCCGCTCAGCAGAAGAAGCTTACAAACAGCAAATCAAAGAAGACAACATAGGGAATCAACTGCTGAGAAAGATGGGCTGG

ACGGGTGGTGGTTTAGGGAAATCTGGTGAGGGCATACGGGAGCCTATCTCAGTTAAAGAGCAGCATAAGCGAGAAGGCCTTGGTCTAGATGTAGAGAGGG

TCAATAAAATTGCTAAGAGGGATATAGAACAAATTATCAGAAACTATGCCCGCTCTGAAAGCCACTCAGATTTGACCTTCTCCACGGAGCTGACCAATGA

TGAACGGAAGCAAATCCATCAGATTGCTCAGAAGTATGGCCTGAAGAGTAAGTCTCATGGGGTGGGCCATGATAGGTACCTGGTGGTAGGTCGAAAACGG

CGGAAGGAAGACCTACTAGATCAACTCAAACAGGAGGGCCAAGTGGGACATTATGAGCTTGTTATGCCCCAAGCAAACTAAGATTTTACTAAGTTGTCTT

ATAAATGCCTCATGAGGTAGATACACAAATAACAAAAAAAGCTATATGTTCTGGTTGAAGAGTATTCATTCTTAAGATGTTTCACCTTGTTCATTTCATA

TAGTGCTTTATTAGGTATTGGAACCTAGAGAATTCTGTCCACTTGTATTCTTAGCTTAATCCAGCAGATGATATTGTGCAGTTACTGTTTGTGTCTTTGA

TATGGCTCTGTTCCCTCAGATTTTAGTAGTTTGTACAAGTAAAAACACCCATCTAAGTGCAATTTCACCCTGAGGCAAATACTTCACATTATAAAGGGCA

TAGCACAGCCATCTGCAACAATATGTAAAGTCAATGCTGACTCTTAACTACGCTAATTCCAGATTTACTTAACATGTCAGGTCATTTTGTATCACCAATT

TTCATCTTTGTGAGAAGCCAGTTGTAGAGCATTTAACAATAAATTGTGCTGTACGTGTAAATGTCTTTATCAACTAAATGATGTAAAATTTTCTTTAAAG

TAATTTTAGTGTGTGTTTGTTTATAACTTCTACCCTGTGATTTCCAGGATATTGGAAGTGATTTACTGTATCTTGTGACATATGACTTTTAAACAAATTC

TAGTCTTCATGCTGAGAGAGCACTACTGAGAGAGATGTCGAAAAGTTTCCAAAAAGCCTTGATTCAATCAGAAGAAAGAAAGCTTGAACTGTTTGTTCTT

GGTGCCTTGCAGAGAGACTCAGAGCAACTCTCCATTGTAGCTTTCACATGGTTTGTGCACCACACCCAAGGCAACCATAGCTGTGGTAGAGCTTGGTAAA

AGACTGAAGATACACTGGTGCTTTGATGAAAAAGGTCAGTTGGCTGGTTCCCCTCTCAAAAAGCTTATTACTCCCAAAGCCAACTTTGTAACATACTTAA

AACTGCTATTTTCGCTTATTTCTGGAATGTAAAAATGTATAAAAATAAGAGTTAGTGTATGCTTCCTGAATAAAAAGGAGCCAAAGTTGATC
Translation
 - UNI30867 - MEKILHMAEGIDIGEMPSYDLMLPKPSKGQKRYLSTYDG - UNI30867 - GQNPPKKQAGSKFHVRARFEPVHFVASSSKAER

QEDPYGPQTKDVNGRTHFASMPRNFYQDYTQDSFSIQDGNSQYCNSSGFIFTKDQPVATNMYFDSGNPAPSSTSQQANCQPAPEPPPSQMYPESLVAEKQ

YFIEKLTATIWKNLSNPEMTSGSDKINYTYMLTRCIQACKTNPEYIYAPLKEIPPADIPKNKKLLTDGYACEVRCQNIYLTTGYAGSKNGSRDRATELAV

KLLQKRIEVRVVRRKFKHIIGEDLVVCQIGMLSYEFPPALKPPEDLVVLGKDASGQPIFNSSAKHWTNFVITENANDAIGILNNSASFNKMSIEYKYEMM

PNRTWRCRVFLQDHCLAEGYGTKKTSKHAAADEALKVLQKTQPTYPSVKSSQCHSGSSPKGSGKKKDIKDLVVYENSSNPVCTLNDTAQFNRMTVEYVYE

RMTGLRWKCKVILESEVIAEAVGVKKSVKYEAAGEAVKTLKKTQPTVINNLKKGTVEDVISRNEIQGRSAEEAYKQQIKEDNIGNQLLRKMGWTGGGLGK

SGEGIREPISVKEQHKREGLGLDVERVNKIAKRDIEQIIRNYARSESHSDLTFSTELTNDERKQIHQIAQKYGLKSKSHGVGHDRYLVVGRKRRKEDLLD

QLKQEGQVGHYELVMPQAN

For any suggestions or comments, please send an email to unitrap@crg.es