Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044150 (A830080D01Rik)
Chromosomal location
Chr X: 155970600 - 156031013 (+)
Description
RIKEN cDNA A830080D01 gene Gene [Source:MGI Symbol;Acc:MGI:2685992]
RefSeq_dna
NM_001033472 
RefSeq_peptide
NP_001028644.2 
UniGene
Mm.296254 
MGI
MGI:2685992 
Uniprot/SWISSPROT
A2AG58 
Uniprot/SPTREMBL
A2AG55 
Human Ortholog
ENSG00000173681 (CXorf23)
Omim not available
UniTrap UNI6910
Vector Insertion
Chr X: 155970768 - 155986170
Public Clones (sanger) RRX150 (baygenomics) D041G10 (ggtc) D029F11 (ggtc) P098F06 (ggtc)
D138G04 (ggtc) H006D03 (ggtc) P103H08 (ggtc) P093C05 (ggtc) P094F07 (ggtc)
D040G10 (ggtc) D149D07 (ggtc) PST5515-NR (escells) PST4615-NR (escells)
PST1406-NL (escells) IST14500E12 (tigm) IST14559E6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16723
Vector Insertion
Chr X: 155986170 - 155986248
Public Clones not available
Private Clones OST455476 (lexicon) OST436273 (lexicon) OST381471 (lexicon) OST376158 (lexicon)
OST369351 (lexicon) OST343062 (lexicon) OST328317 (lexicon) OST299951 (lexicon)
OST263315 (lexicon) OST216628 (lexicon) OST204630 (lexicon) OST195516 (lexicon)
OST126847 (lexicon) OST125050 (lexicon) OST64779 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12940
Vector Insertion
Chr X: 155986248 - 155989682
Public Clones CMHD-GT_352E3-3 (cmhd)
Private Clones OST347227 (lexicon) OST312851 (lexicon) OST143975 (lexicon) OST142003 (lexicon)
OST119309 (lexicon) OST109431 (lexicon) OST66675 (lexicon) OST61780 (lexicon)
OST51055 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1309
Vector Insertion
Chr X: 155993583 - 155995374
Public Clones DC0136 (sanger) W096B04 (ggtc) W069B04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2176
Vector Insertion
Chr X: 156013030 - 156030002
Public Clones XS0682 (sanger) XS0684 (sanger) XS0338 (sanger) XB455 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12786
Vector Insertion
Chr X: 156030002 - 156031014
Public Clones CMHD-GT_368B3-3 (cmhd)
Private Clones OST54935 (lexicon)
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112464
Sequence
GGGTCCCGGCCCGCGGGGAGAGCTGGGTGCTGGTTGGAGCAGGAGGCGGGAGCTGCGCGACGGGCGAGGCGGTGAGGGAGCAGCAACAGCGGCGGCGGCT

GTAGCGGCGGAGGCTTCGGCGACGGCGACAGCGACAGCGACGGGCTCTGGTGACGACTTCTCTGAGGG - UNI6910 - - UNI16723 - TGTAAA

AAGTGGATCAGGCAGCTCATATGCTAAAGGATGGCACGGTCAAGATCCAGATCCCCCAGGTGGAAACAAAG - UNI12940 - - UNI16723 - GT

CATTATCGCCACAATCTAGAAATTTTGAATACCATGAGGAAAGACATTTCCATGGGCACTATGACCCTGAATATAGACATGATCAACAAAGACCCTTTAC

TTGGAGAATGGATGATGAAAAACATGGACAAAATAAACCAAGGATTCCCCCTCGTGTGAATTCGTATCATCGGTCTTATGTAAATAGATCACCTTCTCCA

AATGTAAAACCTGTTGAAAAATTTGATACATATAAGCCTCACCAAGAATATTTTCCTGGCAGAGGAGATGATGACAGACGATCTCAGTATATGCCCACAT

ACACAGAAAGTGCAGCAACCTACATGGAGCACGAAAGGGATTGTTATATCCCTACAGTGCAAGGAAGGTATACTCCTGATGATCACAGAGGTAGAGGTAG

AGGAAGTGGGAGAGGAGAGAAGCCACCTCAGATGTCACTGGGGAAGCCACCTAAGATGTCACTGGGGAAGCCACCTCAGATGTCACTGGCAGATTCCTTG

AGATTTAAAGAGAAATGGCATGAAGATGAATTGAGACACCAGAGGGTACAAGAAGAAAGCTACCCTCAGTCACCCAGAAGAGGCTCAGAAGACTTTGGCA

CAAGGAACCCTTTTCAAAAGAG GTATCCCGAGGATCATGATTTCAGAAAGTATGGCTACACATCAAAAAGACCTACAGATGCAGCAAGGTATGAAAATA

GAGATCCAGCCAGAATCCCAAAGTGGAAGCCTGAGCATTCTTTTCTACCTTTCCAAGAGAAGAAAGAAGAGTGGAGCTTTGGAGCCCAAGGTCACAGATA

TACTGAGAGAGAGTACCCAGAGAGAAGCTCGACAACCAGAGTATCCTACGACTACCGTCACAAACATCATAAGCTCTCAGAGAGCGAGCAGGACTTTCCT

GATGGCAGATTTCACAAGCACTTAAAGGAAGAAGACAGAAAATACAGTTCTATAAAAGCTCCTGCAAATAGAGAGTTAGATTGTTTCAGTACTACAAGAG

GAAGAGAAATTGAGAATGAGCAAATCAATGGACCTTTTTATCTCTACAACAAAAACTCTGTTTCCTATAATCATACAAATATAAAGGATGCTGATTTGGA

GCCTTGCAATGACAAATGGAAGAAAAAAATTAGTAAAGAAGATTGCAGAAAAGAGAATGCATCTTTTAGTAAACAGTTTGATACAAGCCCAAAACCTGAA

GAGAAATGCTATTCACTTATCAAGAAGAAACCACTTTCTGTCAAAGTAGACAGAAACAAGACAGACACATTTAG GTCTACTTCTAGATATTCTGCAGAG

AGACAGATATCACATGATTTGGTTGCTATTGGCAAAACAAGTGACAATTTTCATCCAGTATTTCAACATCTTGACTCGACTCAGAATCCTGAAAATAAAC

CTACTGAAGAATTTGCTCAGGAAATCATAACACTAATCCACAAAGTTAAAG - UNI1309 - CAGATAGTTTTGTAACACCTGATATTACTCTAAATG

AACGTTTCTCAAGAATAAAAAACAGACAGGATGCAGATTTCAATCAAACGAAATCAAATTCAGATCCAGAATTTCACAG GCGAATAGATATGTCTTTGG

ATGATTTTCAGAATAAATATACGATGGTATATGAACCAGATAAG ACTCTGGTCAAAGTAATAGAACCAAATGATCTACGACATGACATTGAGAGAAGGA

GAAAAGAGCGATTACAGAATGAAGATGAGAATATTTTTCACATGGCTAGTCCTACAGAGAG GAATCATCAGTCTCCCAGTTTTTCAAAGGTGAAGACTA

TTCGTGCTGATGGATTTCAAAAGCCTCCACATTTTATAAAATCAAATTTTAGAAAATTTATTCAGAAACCTTACATA AACTATACTATGCAGAGAAAAG

ATGCCATTGATCAGAAGATATTTAGAGTTGAGGAAAATCATCAGAACAGAAGAGGCTCTAAAGGATCTTTTAAG AACTTTTTGGGTGGCAGATTCCAGC

CTCATTATAAATCACACCTGGTACAGAAGAGCATGTATATTCAGGCTAAATACCAGCGCTTACGGTTTGCTGGACCAAGAGGATTTATTACCAATAAATT

CAGAAACAGATTTCTGAGGAAAAAAAAG - UNI2176 - - UNI12786 - GAATACCCAGTATTGCCAAGGACAAACAACCTGGAATTGTTGCAAG

TGGAGCCAACCCTATATGAAGACTTAACTGAGCATCTCATTTTTGTCAGGAATTGGAATTGACACTAATACTGTAACTTTCTTGATAAAATATCTTTATT

TTTCAGTAGTGGAATGCTGCAACTTTTTTACAGTATTCAATTTCAGAAGTTGTATTTAACTACAAGCTCTTTTGCAAAAACTCTCAGCAGAAGCATTTGA

GGGGCACTCTTTGTTGATGCATCTTTCTCTCAGCATGGTTTCACTGAGAGAATTTAATTAAATTACATGTAAACATTTATATGTTGAAAGCTTTCTGTTA

TAAGAACAGGTGTCAGAATTATTTAGTGTCTGTACATGAAAGAACTTTTAAACAGTGGCCTTACAGTATCAAATTTTATACTGGCTTTTCTTTTTCTGAT

GACATTTTGGCTTCTAACTTGAAGTTTTCTGAAGTTTCTGAAGATCAAGGCCTGTATGTGTCATCCATTTTGTAATACAATATAAGAAGCTTAAAGAAGA

GGTGCATCTTCTCCATCGGGTCGTGTGTATCTTGGGTTTTCCCATGACCATTTGCTCTTTTCTAGTTTCAAATGCTATTGTGGAAAATATGTAAGGATTT

TATAATCTCTATTCCATCTTCTTTTCCCTCAGGGCAAGCTTATGCATATTATATTTTTAAAGGCTTTTAAAATCTGACAGACAAAACTGCATATTTGAAC

ATTGTACTTTACTACTACGGTATTAGACATTTTGCAGACACATCTTACAGACAGCATATCTTTGGTTCAGTTGATAGATATTTCATATCTACTATGTGTA

AGATAGGATCCATGGGATCGTAAATACAGTCTATAGGTCCAAAAACTTCTTTGTTTTCTTTCTTCTGCTTAAAAGTACATATACATTCCCAGTCAAATTT

TTGTGACATGTTTATTTGTAAGAAAATAAAATATTGTTCTTTCTGCTTGAAGCTGTTACCTGGCA
Translation
 - UNI6910 - - UNI16723 - MARSRSRSPRWKQR - UNI12940 - - UNI16723 - RSLSPQSRNFEYHEERHFHGHYDPEYRHDQQRP

FTWRMDDEKHGQNKPRIPPRVNSYHRSYVNRSPSPNVKPVEKFDTYKPHQEYFPGRGDDDRRSQYMPTYTESAATYMEHERDCYIPTVQGRYTPDDHRGR

GRGSGRGEKPPQMSLGKPPKMSLGKPPQMSLADSLRFKEKWHEDELRHQRVQEESYPQSPRRGSEDFGTRNPFQKR RYPEDHDFRKYGYTSKRPTDAAR

YENRDPARIPKWKPEHSFLPFQEKKEEWSFGAQGHRYTEREYPERSSTTRVSYDYRHKHHKLSESEQDFPDGRFHKHLKEEDRKYSSIKAPANRELDCFS

TTRGREIENEQINGPFYLYNKNSVSYNHTNIKDADLEPCNDKWKKKISKEDCRKENASFSKQFDTSPKPEEKCYSLIKKKPLSVKVDRNKTDTFR RSTS

RYSAERQISHDLVAIGKTSDNFHPVFQHLDSTQNPENKPTEEFAQEIITLIHKVKA - UNI1309 - ADSFVTPDITLNERFSRIKNRQDADFNQTKS

NSDPEFHR RRIDMSLDDFQNKYTMVYEPDK TLVKVIEPNDLRHDIERRRKERLQNEDENIFHMASPTER RNHQSPSFSKVKTIRADGFQKPPHFIKS

NFRKFIQKPYI NYTMQRKDAIDQKIFRVEENHQNRRGSKGSFK NFLGGRFQPHYKSHLVQKSMYIQAKYQRLRFAGPRGFITNKFRNRFLRKKK - U

NI2176 - - UNI12786 - EYPVLPRTNNLELLQVEPTLYEDLTEHLIFVRNWN
Transcript ENSMUST00000057180
Sequence
GGGTCCCGGCCCGCGGGGAGAGCTGGGTGCTGGTTGGAGCAGGAGGCGGGAGCTGCGCGACGGGCGAGGCGGTGAGGGAGCAGCAACAGCGGCGGCGGCT

GTAGCGGCGGAGGCTTCGGCGACGGCGACAGCGACAGCGACGGGCTCTGGTGACGACTTCTCTGAGGG - UNI6910 - - UNI16723 - TGTAAA

AAGTGGATCAGGCAGCTCATATGCTAAAGGATGGCACGGTCAAGATCCAGATCCCCCAGGTGGAAACAAAG - UNI12940 - - UNI16723 - GT

CATTATCGCCACAATCTAGAAATTTTGAATACCATGAGGAAAGACATTTCCATGGGCACTATGACCCTGAATATAGACATGATCAACAAAGACCCTTTAC

TTGGAGAATGGATGATGAAAAACATGGACAAAATAAACCAAGGATTCCCCCTCGTGTGAATTCGTATCATCGGTCTTATGTAAATAGATCACCTTCTCCA

AATGTAAAACCTGTTGAAAAATTTGATACATATAAGCCTCACCAAGAATATTTTCCTGGCAGAGGAGATGATGACAGACGATCTCAGTATATGCCCACAT

ACACAGAAAGTGCAGCAACCTACATGGAGCACGAAAGGGATTGTTATATCCCTACAGTGCAAGGAAGGTATACTCCTGATGATCACAGAGGTAGAGGTAG

AGGAAGTGGGAGAGGAGAGAAGCCACCTCAGATGTCACTGGGGAAGCCACCTAAGATGTCACTGGGGAAGCCACCTCAGATGTCACTGGCAGATTCCTTG

AGATTTAAAGAGAAATGGCATGAAGATGAATTGAGACACCAGAGGGTACAAGAAGAAAGCTACCCTCAGTCACCCAGAAGAGGCTCAGAAGACTTTGGCA

CAAGGAACCCTTTTCAAAAGAG GTATCCCGAGGATCATGATTTCAGAAAGTATGGCTACACATCAAAAAGACCTACAGATGCAGCAAGGTATGAAAATA

GAGATCCAGCCAGAATCCCAAAGTGGAAGCCTGAGCATTCTTTTCTACCTTTCCAAGAGAAGAAAGAAGAGTGGAGCTTTGGAGCCCAAGGTCACAGATA

TACTGAGAGAGAGTACCCAGAGAGAAGCTCGACAACCAGAGTATCCTACGACTACCGTCACAAACATCATAAGCTCTCAGAGAGCGAGCAGGACTTTCCT

GATGGCAGATTTCACAAGCACTTAAAGGAAGAAGACAGAAAATACAGTTCTATAAAAGCTCCTGCAAATAGAGAGTTAGATTGTTTCAGTACTACAAGAG

GAAGAGAAATTGAGAATGAGCAAATCAATGGACCTTTTTATCTCTACAACAAAAACTCTGTTTCCTATAATCATACAAATATAAAGGATGCTGATTTGGA

GCCTTGCAATGACAAATGGAAGAAAAAAATTAGTAAAGAAGATTGCAGAAAAGAGAATGCATCTTTTAGTAAACAGTTTGATACAAGCCCAAAACCTGAA

GAGAAATGCTATTCACTTATCAAGAAGAAACCACTTTCTGTCAAAGTAGACAGAAACAAGACAGACACATTTAG GTCTACTTCTAGATATTCTGCAGAG

AGACAGATATCACATGATTTGGTTGCTATTGGCAAAACAAGTGACAATTTTCATCCAGTATTTCAACATCTTGACTCGACTCAGAATCCTGAAAATAAAC

CTACTGAAGAATTTGCTCAGGAAATCATAACACTAATCCACAAAGTTAAAG - UNI1309 - CAGATAGTTTTGTAACACCTGATATTACTCTAAATG

AACGTTTCTCAAGAATAAAAAACAGACAGGATGCAGATTTCAATCAAACGAAATCAAATTCAGATCCAGAATTTCACAG GCGAATAGATATGTCTTTGG

ATGATTTTCAGAATAAATATACGATGGTATATGAACCAGATAAG ACTCTGGTCAAAGTAATAGAACCAAATGATCTACGACATGACATTGAGAGAAGGA

GAAAAGAGCGATTACAGAATGAAGATGAGAATATTTTTCACATGGCTAGTCCTACAGAGAG AACTATACTATGCAGAGAAAAGATGCCATTGATCAGAA

GATATTTAGAGTTGAGGAAAATCATCAGAACAGAAGAGGCTCTAAAGGATCTTTTAAG AACTTTTTGGGTGGCAGATTCCAGCCTCATTATAAATCACA

CCTGGTACAGAAGAGCATGTATATTCAGGCTAAATACCAGCGCTTACGGTTTGCTGGACCAAGAGGATTTATTACCAATAAATTCAGAAACAGATTTCTG

AGGAAAAAAAAG - UNI2176 - - UNI12786 - GAATACCCAGTATTGCCAAGGACAAACAACCTGGAATTGTTGCAAGTGGAGCCAACCCTATA

TGAAGACTTAACTGAGCATCTCATTTTTGTCAGGAATTGGAATTGACACTAATACTGTAACTTTCTTGATAAAATATCTTTATTTTTCAGTAGTGGAATG

CTGCAACTTTTTTACAGTATTCAATTTCAGAAGTTGTATTTAACTACAAGCTCTTTTGCAAAAACTCTCAGCAGAAGCATTTGAGGGGCACTCTTTGTTG

ATGCATCTTTCTCTCAGCATGGTTTCACTGAGAGAATTTAATTAAATTACATGTAAACATTTATATGTTGAAAGCTTTCTGTTATAAGAACAGGTGTCAG

AATTATTTAGTGTCTGTACATGAAAGAACTTTTAAACAGTGGCCTTACAGTATCAAATTTTATACTGGCTTTTCTTTTTCTGATGACATTTTGGCTTCTA

ACTTGAAGTTTTCTGAAGTTTCTGAAGATCAAGGCCTGTATGTGTCATCCATTTTGTAATACAATATAAGAAGCTTAAAGAAGAGGTGCATCTTCTCCAT

CGGGTCGTGTGTATCTTGGGTTTTCCCATGACCATTTGCTCTTTTCTAGTTTCAAATGCTATTGTGGAAAATATGTAAGGATTTTATAATCTCTATTCCA

TCTTCTTTTCCCTCAGGGCAAGCTTATGCATATTATATTTTTAAAGGCTTTTAAAATCTGACAGACAAAACTGCATATTTGAACATTGTACTTTACTACT

ACGGTATTAGACATTTTGCAGACACATCTTACAGACAGCATATCTTTGGTTCAGTTGATAGATATTTCATATCTACTATGTGTAAGATAGGATCCATGGG

ATCGTAAATACAGTCTATAGGTCCAAAAACTTCTTTGTTTTCTTTCTTCTGCTTAAAAGTACATATACATTCCCAGTCAAATTTTTGTGACATGTTTATT

TGTAAGAAAATAAAATATTGTTCTTTCTGCTTGAAGCTGTTACCTGGCA
Translation
 - UNI6910 - - UNI16723 - MARSRSRSPRWKQR - UNI12940 - - UNI16723 - RSLSPQSRNFEYHEERHFHGHYDPEYRHDQQRP

FTWRMDDEKHGQNKPRIPPRVNSYHRSYVNRSPSPNVKPVEKFDTYKPHQEYFPGRGDDDRRSQYMPTYTESAATYMEHERDCYIPTVQGRYTPDDHRGR

GRGSGRGEKPPQMSLGKPPKMSLGKPPQMSLADSLRFKEKWHEDELRHQRVQEESYPQSPRRGSEDFGTRNPFQKR RYPEDHDFRKYGYTSKRPTDAAR

YENRDPARIPKWKPEHSFLPFQEKKEEWSFGAQGHRYTEREYPERSSTTRVSYDYRHKHHKLSESEQDFPDGRFHKHLKEEDRKYSSIKAPANRELDCFS

TTRGREIENEQINGPFYLYNKNSVSYNHTNIKDADLEPCNDKWKKKISKEDCRKENASFSKQFDTSPKPEEKCYSLIKKKPLSVKVDRNKTDTFR RSTS

RYSAERQISHDLVAIGKTSDNFHPVFQHLDSTQNPENKPTEEFAQEIITLIHKVKA - UNI1309 - ADSFVTPDITLNERFSRIKNRQDADFNQTKS

NSDPEFHR RRIDMSLDDFQNKYTMVYEPDK TLVKVIEPNDLRHDIERRRKERLQNEDENIFHMASPTER RTILCREKMPLIRRYLELRKIIRTEEAL

KDLLR RTFWVADSSLIINHTWYRRACIFRLNTSAYGLLDQEDLLPINSETDF - UNI2176 - - UNI12786 - 

For any suggestions or comments, please send an email to unitrap@crg.es