Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044317 (Gpr4)
Chromosomal location
Chr 7: 19797887 - 19809525 (+)
Description
G protein-coupled receptor 4 Gene [Source:MGI Symbol;Acc:MGI:2441992]
RefSeq_dna
NM_175668 
RefSeq_peptide
NP_783599.1 
UniGene
Mm.135984 
MGI
MGI:2441992 
Uniprot/SPTREMBL
Q80T57 Q8BUD0 
Human Ortholog
ENSG00000177464 (GPR4)
Omim not available
UniTrap UNI21652
Vector Insertion
Chr 7: 19797984 - 19806766
Public Clones D085G06 (ggtc)
Private Clones OST322917 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108469
Sequence
CGTGAGTGGAACAACTTCATCTCCACTCCTCAGTCTCCACCAGGATCAACTCTGAGTCTCCTGGAACCCCCTTCAGAGTCCCCCTCCTACACACAATCCT

GTGCTCCACCACTTACTCACCTTCCTGTTTCCTAGCATCCCTTCCCACAGTCACCAGCCTTTACAAGTCCTTCCTCTTTGTCTGTCCCCAGAGGACACCT

CATTTTTTTTCCTGCTTTGGTGACTTTACATAGTTCTCTTTCCAGCTGGTGTCCTAGCAGATGCCAGCACTCTTAAAATTGCATCTTGCCAACTCTGTGA

CTTCTCTCCATGCTCCCATGTCTTTCCTTAGTCTTCTAGAACATTCCATCCCATTGGTACTTCACCATGTCCATATTGACTTCCTAAGATTTCAATAAGC

ATGACACCGCTGGTGTCTTCATCTCCTCTGTAAACACTGCCTTGACCTTTTTTTTTCTGGTGCCATCTTTGTGCTCTGGTTGTGTAGATAGCCCATTGAC

ATTAGTTCCACCTCTTATCCTTACCTTCATCATCCCTTGACACTCTTCCTCTCAAGTCCTCCCTTTGCTTAGCCTGCCACAAAGCAAACCCAGACCTCAG

TCCTCGTGAACTGTCTCCTGTGATGTTCCCCTGAGCCTCCAAAGAGGGGGCTCAGGGGGCCTGATGGCCTCCCGCCCCCCGTGGCCCTGTAGCCCCAGCG

GGCCAGGGGAAGCTCCTGGGAAGCCCCATCGCCCAGGATGGACAACAGCACGGGCACAGGGGAGGGCTGCCATGTGGACTCTCGAGTGGACCACCTCTTC

CCACCATCTCTCTACATCTTCGTCATCGGGGTGGGGCTGCCCACCAACTGCCTGGCCCTGTGGGCAGCCTACCGGCAGGTGCGCCAACACAATGAGCTGG

GCGTCTACCTGATGAACTTGAGCATTGCAGACCTGCTGTACATCTGCACTTTGCCGCTGTGGGTCGACTACTTCCTCCACCATGACAACTGGATCCACGG

CCCTGGCTCCTGCAAGCTCTTTGGCTTCATCTTCTACAGCAACATCTATATCAGCATCGCCTTCCTGTGCTGCATCTCCGTGGACCGCTACCTGGCTGTG

GCTCATCCTCTGCGCTTTGCACGCCTGCGCCGGGTCAAGACAGCAGTGGCTGTGAGCTCTGTGGTCTGGGCCACGGAGCTGGGCGCCAATTCAGCACCGC

TCTTCCATGATGAGCTGTTTCGTGATCGCTACAACCACACCTTCTGCTTTGAGAAGTTCCCCATGGAGCGTTGGGTGGCCTGGATGAATCTGTACCGCGT

CTTTGTGGGCTTCCTCTTCCCCTGGGCACTCATGTTGCTGTGCTACCGTGGCATCCTGAGGGCAGTGCAGAGCAGTGTGTCCACCGAGCGCCAGGAGAAA

GTCAAGATCAAACGTCTGGCCCTGAGCCTCATCGCCATTGTGCTGGTGTGCTTTGCGCCTTACCATGCTCTCCTGCTGTCTCGCAGCGCCGTCTACCTGG

GCCGGCCCTGGGACTGTGGCTTCGAGGAGCGAGTCTTTTCTGCCTACCACAGCTCCCTGGCCTTCACCAGCCTCAATTGTGTGGCTGACCCCATCCTCTA

CTGCCTGGTCAACGAGGGTGCCCGCAGTGATGTGGCCAAGGCCCTGCACAACCTCCTCCGCTTCCTGGCCAGCAACAAGCCCCAGGAGATGGCCAATGCT

TCCCTCACCCTGGAGACACCCTTGACCTCCAAGAGGAGCACCACCGGCAAGTCGTCCGGGGCTGTCTGGGCAGTGCCTCCGACTGCCCAGGGGGACCAGG

TGCCACTGAAGGTGCTGCTGCCCCCGGCACAGTGAGCCCCATGCCCAACTGTCATCCTGCACCCTTCCGGTTGTATGCAAATGTGTGTAAATATGTCCAT

GTGAATT
Translation
MDNSTGTGEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVRQHNELGVYLMNLSIADLLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFY

SNIYISIAFLCCISVDRYLAVAHPLRFARLRRVKTAVAVSSVVWATELGANSAPLFHDELFRDRYNHTFCFEKFPMERWVAWMNLYRVFVGFLFPWALML

LCYRGILRAVQSSVSTERQEKVKIKRLALSLIAIVLVCFAPYHALLLSRSAVYLGRPWDCGFEERVFSAYHSSLAFTSLNCVADPILYCLVNEGARSDVA

KALHNLLRFLASNKPQEMANASLTLETPLTSKRSTTGKSSGAVWAVPPTAQGDQVPLKVLLPPAQ
Transcript ENSMUST00000060225
Sequence
GCTGTCCTGCCCCGCGGGGGCGCCCGCCGGGTCCCTGTGCTGTGCAGAGTCGGGACCAAGTCAGAGACGCCGGTCGCCCAGCCCAGCCGCGGAGCAG - 

UNI21652 - GCCTAGCAATCTCAGCTCTCAATGCAGTCGTGAGTGGAACAACTTCATCTCCACTCCTCAGTCTCCACCAGGATCAACTCTGAGTCTCC

TGGAACCCCCTTCAGAGTCCCCCTCCTACACACAATCCTGTGCTCCACCACTTACTCACCTTCCTGTTTCCTAGCATCCCTTCCCACAGTCACCAGCCTT

TACAAGTCCTTCCTCTTTGTCTGTCCCCAGAGGACACCTCATTTTTTTTCCTGCTTTGGTGACTTTACATAGTTCTCTTTCCAGCTGGTGTCCTAGCAGA

TGCCAGCACTCTTAAAATTGCATCTTGCCAACTCTGTGACTTCTCTCCATGCTCCCATGTCTTTCCTTAGTCTTCTAGAACATTCCATCCCATTGGTACT

TCACCATGTCCATATTGACTTCCTAAGATTTCAATAAGCATGACACCGCTGGTGTCTTCATCTCCTCTGTAAACACTGCCTTGACCTTTTTTTTTCTGGT

GCCATCTTTGTGCTCTGGTTGTGTAGATAGCCCATTGACATTAGTTCCACCTCTTATCCTTACCTTCATCATCCCTTGACACTCTTCCTCTCAAGTCCTC

CCTTTGCTTAGCCTGCCACAAAGCAAACCCAGACCTCAGTCCTCGTGAACTGTCTCCTGTGATGTTCCCCTGAGCCTCCAAAGAGGGGGCTCAGGGGGCC

TGATGGCCTCCCGCCCCCCGTGGCCCTGTAGCCCCAGCGGGCCAGGGGAAGCTCCTGGGAAGCCCCATCGCCCAGGATGGACAACAGCACGGGCACAGGG

GAGGGCTGCCATGTGGACTCTCGAGTGGACCACCTCTTCCCACCATCTCTCTACATCTTCGTCATCGGGGTGGGGCTGCCCACCAACTGCCTGGCCCTGT

GGGCAGCCTACCGGCAGGTGCGCCAACACAATGAGCTGGGCGTCTACCTGATGAACTTGAGCATTGCAGACCTGCTGTACATCTGCACTTTGCCGCTGTG

GGTCGACTACTTCCTCCACCATGACAACTGGATCCACGGCCCTGGCTCCTGCAAGCTCTTTGGCTTCATCTTCTACAGCAACATCTATATCAGCATCGCC

TTCCTGTGCTGCATCTCCGTGGACCGCTACCTGGCTGTGGCTCATCCTCTGCGCTTTGCACGCCTGCGCCGGGTCAAGACAGCAGTGGCTGTGAGCTCTG

TGGTCTGGGCCACGGAGCTGGGCGCCAATTCAGCACCGCTCTTCCATGATGAGCTGTTTCGTGATCGCTACAACCACACCTTCTGCTTTGAGAAGTTCCC

CATGGAGCGTTGGGTGGCCTGGATGAATCTGTACCGCGTCTTTGTGGGCTTCCTCTTCCCCTGGGCACTCATGTTGCTGTGCTACCGTGGCATCCTGAGG

GCAGTGCAGAGCAGTGTGTCCACCGAGCGCCAGGAGAAAGTCAAGATCAAACGTCTGGCCCTGAGCCTCATCGCCATTGTGCTGGTGTGCTTTGCGCCTT

ACCATGCTCTCCTGCTGTCTCGCAGCGCCGTCTACCTGGGCCGGCCCTGGGACTGTGGCTTCGAGGAGCGAGTCTTTTCTGCCTACCACAGCTCCCTGGC

CTTCACCAGCCTCAATTGTGTGGCTGACCCCATCCTCTACTGCCTGGTCAACGAGGGTGCCCGCAGTGATGTGGCCAAGGCCCTGCACAACCTCCTCCGC

TTCCTGGCCAGCAACAAGCCCCAGGAGATGGCCAATGCTTCCCTCACCCTGGAGACACCCTTGACCTCCAAGAGGAGCACCACCGGCAAGTCGTCCGGGG

CTGTCTGGGCAGTGCCTCCGACTGCCCAGGGGGACCAGGTGCCACTGAAGGTGCTGCTGCCCCCGGCACAGTGAGCCCCATGCCCAACTGTCATCCTGCA

CCCTTCCGGTTGTATGCAAATGTGTGTAAATATGTCCATGTGAATTACAAGAAAAAAATGAGGTTTTTTTTTTCTCTCTGTCATCTTCTTCCACTATGAT

CCCCAATGATTCACTTAATCCCAGCAGGGTCTGAAGGGGGAACAACACAGCCAGGAGTTTGTCATCATGGGCGCCCAGATGGGGAGCCAGCCATGGAGAG

TTTGGGATGAGGGGATAATTAAGCCAACTGCTTGGTTTCTGGCAGATAAGGACAGACGAGTCTGATCAGATGCTACAAGTGTGTGATTCCAGCTACTTGG

GAGGCCGAGGAAAGATTTGGAAGTTCAAGACCCACTTGGACCACAAAGTGAAGCCCTGTCTCAAAATATTAAATACAACAAAGCCCGGGGATGTAATCTA

GCAGTTTTTATCTAAAATTCCCAGTGAGGGGCTTGGGGCGTGGCCCAAGTGGGAGAGCCCCTGCCTAGAATCCATTCTGGTAATACCTAGCATGCTGGTA

ATTCCTTCTTGTTTGTATTTTGGAAAGCTATTTACCACAGTCTGGCTTTGAGGTTATGGTCTTCCTTCCTCAGCTTCCCAAGTGCTAGGCTTACAGATGT

TAACTGCTATGTCAAGCAGATATTCTGAGATTCTACACAAACAGCATTCTCTCAGTCTCAGATGGTGAAGGAGGACAGGGACTGTCAAGAGCAGGTAAGA

GCCAATCTGAGCAGCCTGCCTGAAGGAATCGTAAGCAGGGCTGGTTTAGAAAGGAGGCCCAGGACAGGAAGAGCATCCATTCATGCACTGTCTAATCACA

TCTTGCCTCAGAGATTAGGTTGGTCTGTGAAGACCAGATCCTGCTATCAGGGAGGTAGGACTAACAATAAAAAATAAACATAGCAAGACAATTCCCTT
Translation
 - UNI21652 - MDNSTGTGEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVRQHNELGVYLMNLSIADLLYICTLPLWVDYFLHHDNWI

HGPGSCKLFGFIFYSNIYISIAFLCCISVDRYLAVAHPLRFARLRRVKTAVAVSSVVWATELGANSAPLFHDELFRDRYNHTFCFEKFPMERWVAWMNLY

RVFVGFLFPWALMLLCYRGILRAVQSSVSTERQEKVKIKRLALSLIAIVLVCFAPYHALLLSRSAVYLGRPWDCGFEERVFSAYHSSLAFTSLNCVADPI

LYCLVNEGARSDVAKALHNLLRFLASNKPQEMANASLTLETPLTSKRSTTGKSSGAVWAVPPTAQGDQVPLKVLLPPAQ

For any suggestions or comments, please send an email to unitrap@crg.es