Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044349 (A930034L06Rik)
Chromosomal location
Chr 2: 158201374 - 158211881 (+)
Description
small nucleolar RNA host gene 11 (non-protein coding) Gene [Source:MGI Symbol;Acc:MGI:2441845]
RefSeq_dna
NM_175692 
RefSeq_peptide
NP_783623.2 
UniGene
Mm.294494 Mm.395869 Mm.465573 
MGI
MGI:2441845 
Uniprot/SPTREMBL
Q8BV32 Q4G0K9 
Human Ortholog
not available
Omim not available
UniTrap UNI17468
Vector Insertion
Chr 2: 158201625 - 158201935
Public Clones not available
Private Clones OST442178 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000059573
Sequence
ATGAGCCTTTGCCGCAAGGCCCTCTTGACACCAAGGATGACGACGCAAAACCTGCGGCAGCCAACACCCCTCTCCCCACTCTCCGCACTCACTGGTGGG 

CCACCATCCAGGAAGCAAGTATCCCG AATTGACAGCTTGGTGCAGAGGGGACATGAGAGGTGTCTCTGTCCAGCTAGGAAGCAGCTGGACCACAGCGCT

CCCAAG GAACGTACTCCCCAACATCAGTGTGGAGCGACCAGAGAGCATGACCATCTCGCAGTGATCGCCTGCAGGGGCCTTAGCCAG GTGATGGTGGT

GGTACCCAGGAAGAGCAAGGTTGCTGGCACGCAACATGCCTGCAGCCCTTGA
Translation
MSLCRKALLTPRMTTQNLRQPTPLSPLSALTGG PPSRKQVSR RIDSLVQRGHERCLCPARKQLDHSAPK ERTPQHQCGATREHDHLAVIACRGLSQ 

VMVVVPRKSKVAGTQHACSP
Transcript ENSMUST00000109488
Sequence
AGCGCGCGCAGCCGCAGCTGGGCAGACACTGCGGTTTTCGGGGAGTGTCCTGCGCAGTCCCGCACTGCGGCACTCACTCACGCACTCAGCCTGCTAGGCA

AGTCACCTCGGCTCTGCGCTCTTGGCCGCTTCCAAGACCTCCAGTCTTCTTTAACCGGATAAACCCAGGAGCCGGGAAGCTAGGGTGCAGGCGTGATCCT

CCAACCCTTGAGAGCTATGGACCTCCTGGAGTACTGGAAAAGAGATCGTTG - UNI17468 - GGTTCTCGGACTGTTGACCTGCGTCCTTCCAAGCT

GATAAGCCCAGGACCCTAGGACGGGATGCTAGGACTCCTGTGTGGCGCCTTGCTTTGAACCCTTTCCCAAGGGCTGTTTCCCAGATGAGCCTTTGCCGCA

AGGCCCTCTTGACACCAAGGATGACGACGCAAAACCTGCGGCAGCCAACACCCCTCTCCCCACTCTCCGCACTCACTGGTGGGTGCCACCATCCAGGAAG

CAAGTATCCCG AATTGACAGCTTGGTGCAGAGGGGACATGAGAGGTGTCTCTGTCCAGCTAGGAAGCAGCTGGACCACAGCGCTCCCAAG GAACGTAC

TCCCCAACATCAGTGTGGAGCGACCAGAGAGCATGACCATCTCGCAGTGATCGCCTGCAGGGGCCTTAGCCAG GTGATGGTGGTGGTACCCAGGAAGAG

CAAGGTTGCTGGCACGCAACATGCCTGCAGCCCTTGATGCTGTTGGCTCACCAGCACGGAGCACCTTTTTACTTTGGTAGGTATGCAGAGGGAAGGGCCT

TGACTCTGGAGACTTGGGGACCAAAGTTAGAGACTCGCTAGGTCTGTCCCTCCCTTTAGAGCCACAGAATGCCACGTGGCACTGAGGTTCTTGCTCTCAC

AAATAAGCACTCGGGAAACCAGCCGTGTTAAACACGCAGGTTGTCTCTTCAAAGGGAGAGACATATATCCTGTTTTCCTCCCAGAAGGCTGGGAGCGGAG

GTGTTTAATATCCTGGCGAACTTTGTGCTATCTGTATGACCAAGACCATGTCAGAGCCTCCCCTAGAGCCTTAAGGTATCATCTATAATGGGTCAGCTAG

GTGGGGGGGGGGGGGCGCATGCCTTTACTTCCGGTATTCTTCTCCTAAACCCTTAAGATGTCATATGTAATCAGTCACCTGGGTGGTGGTGGTGCATGCC

TTTATTTCCAGGACTTGGGTGGCAAAGGTGGGTGGATCTCTGAGTTCGAGGCCAGCCTGGTCTACAGAGTGAGTCCAGGTCAGCCAGGACTACACAGAGA

AATCTTCTGTCTCAAATAAACAAAACAAAACAAAAAATAAATAATTTAAAAAAAAGATGTCACGTGTAGTCAATTATCTTTATGGAAAATGTCATGACTT

AAGCTTTATTATGTTAAACTACCTGGTATCAGACTCTTGAAGTTTGAACCAACACTTAGCCGGGCGATGGTGGCGCACGCCTTTAATCCCAGCACTTGGG

AGGCAGAGACAGGTGAATCTTTGAGTTAGAGGCTAGCCTGGTCTACCGAGTGAGTCCGGGACAGCCAGGATTACACAGAGAAACCCTGTCTCAAACATAG

AATTAAGTAAACTAAAGTAATAAAGACATTTGAATCAACACTGGCTACTGAGTCATGTTGAACCAGATGGCCTTTTTTACCTTACTTGGGTTACCACCCT

GGCTGTTTGAGATACCTGCAAGGACCCCCCACAATGGCGACCAACATGAGAGTCTCCAGTCTTGGAGTAGGTAAGAGAATTTTTCTCTAGTCACCCAGGA

GCAGTGCGTGCTCTCACCCAGGAGGTAACAGGTAAGTGGGAAGATAGAATATGCCTGGATTCTTCCCAGTCCTGAAACAAAGCTTTTTTTTTTTTTTTTT

TTTTTTTACAATTACTGAGCTGTTGGTTAAGATCCAGAGGAGGGAAATAGTTAGAGCAACAGAGCTGCAGCTCTGCACAAGTGTCAGTCAGATTCAGTCC

CTTGGCTTCCTGAACAAGAAATGATTGATGTTGAAAATTGGAAATGCAGCCAGGTGGTGGTGACGGTCTATAGACAGGACTACCAGGCCTAAATAAACAG

GGTCAACTGGACCCCTAAGAAAGATGAGATAAAATGCGTGCCGATTATTTTGCTAGGTGAAGTTCACGTATTGTCCTGTGTGGCGCGCAGTCTCTCTCGG

GAGGGAGGATCATTAAAGAAGGTTTTGTTTTCTCTGTAGGTTGCCGTGGACTCCGCTGCTGGCGCTCCGCAGAAGCCACCTGGAGGATGACCAGCCAGGA

TTGTTCAGGGCTTTCATTGTCTTGGTCACATTGCTTCATTGTCTTTGTCTGTCCAACCGTCTGTCTAATCAGCCTTAGCAAAATAAGCTATTTTATCTTG

TCCTTTCGATTAAAAAAAACAACAAAAGACAGACTTCAAGCCGTTTTGGCACCCAGAGACCAAACCCCACCCAGAGTCTTTGTTTTTATGATTACTAAAA

CTTCATGTCTTAAATTTATATCTTTGTAAAACAGAAAAAAATTTAAATAGCAATGTGATCAAACTTGGATTTTAAAAAAAATAGGGGCAAATTGGAACCA

AGAAGGAATATTTCTTATGGATAATACGGTGGCCAAGGACTGAAAAACAGAAGTGTAGTCGATAGGAGTTAGATTACTTGAAAGTTTCCACCTAAGATTT

TTTTGGTACAGCCTGAGAATAGGTGGGATGTAGTAAGGAATAGAACGGTCCAGAAAGTTCTTCTTCCATGGAAATGTTATTCTTCGATACTGTTCACATG

TTTGTTTTGTTTGCAGTGTCAACCGGACATGTTCTTTCACACTCTCGTGGGACAACCCAGTTGTTTCCCACTTCGGGATGTTCTGTGATGGTTCCTCAGG

TACTTTGTAATCTCCTGTTAACCTGATAGGAGAGTCTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCTTTCT

TTCTTTCTTTCTTTCCTTCCTTCCTTCCTTCCTTCCTTCTTTCCTTCTTTCCTTCTTTCCTTCTTCTTCTTCCTCTTCCTCTTCTTCCTCTTCTTCCTCT

TCTTCCTCTTCCTCTTCTTCTTCTTCCTTCTCCTTCTCTTACTCCTCCTCCTTCTCCTCCTCCTCCTTCTTCTCCTTCTCCTCCTCCTTCTATTCCTCCT

TCTCCTCTTCCTCCTCCTCCTTCTCCTCCTCCTCCTCCTTCTCCTTCTTTTTAAAGATTTATTTGTTATTATGTGTAAGTACACTGTAGCTGTCTTCAGA

CACTCCAGGAGAGGTTATCAGATCTTATTACAGATGGTTGTGGGCCACCATATGGTTGCTAGGAATTAACTCAGGACCTCTGGAAGGGCAGTCAGTGCTC

TTAACTGCTGAGCCACCTCTCCAGCCCTTATCTTTAATTTCTAATAACTAATGATATTGCATATATTTCCCCTTACCATTCCTCTCTTGTGTGGCAAATG

TTTGTTCAAAGCCATTGTACAATTTTTACTGCTGGTAGTAGCTTTCTTATTTTTGAGGGCTTTGCTTTATTTTAGTAGTTTTTTTTTTAATGTAGCAAGA

TAACATAATATCACCATTTTAGCCATTTACCTAAGCAAGCCTCAAACTTGCCATGCTGGTCTTGAACTCATAATCTTCCTGCCCCCAGCCTAAGCGCTGG

GCTATAGGGACATGCCATCATTGGCGCTGTTTTGTTTGTACATTTGCTTTTTCTTAAAAAAGATTTATTTATTTATTTATTATCTGTAAGTACACTGTAG

CTGTCTTCAGACACCCCAGAAATGGACATCAGGTCCCATTATAGATGGTTGTGAGCCACCATGTGGTTGCTGGGATTTGAACTCCGGACCTTCAGAAGAG

CAGTCAGTGCTCTTAATCTCTGAGCCATCTCTCCAGCCCCCAGGAGAGTCTTCTTGAACTCAAAATTCAAATTGCCCTAAAATGTAAAGATCCCAAATCT

TACATAAATAGCCTTAGGTTTAAATCTTTCAAAGTTAATGTGAATTAAGTAGGATTTGCTTGTGGTTTAGTTTTGTGCCTGCCCTTGGTCTGACGTAAAG

GAGCAGACAAGGGAAGAAGTTAGGGGAGGCTCAAGAGCCCTGCCTTCTGTTCAAGGCTCATGTTACACAGTATTCCAAGTTTCTAGTGCATATTAGTAGT

GAGAGGTTCTCGCATCAGTGTGACATCTACAACTGTGTCTGGGGCCTTGTCTTCTGTCTGTAGAGACCTGTGCTCGTGTACACTGCAGGCATGTATTATG

CCTCTCCCTAATTAGACAGCAGGAGAATACAGCCCCAAGCATGGCATAGGGTCCTGGGGGCTCCAGGAAAACACCATTCTGTCATATCTTCAACTTGACT

TTGTCAGATAGCTCTTTACACATTTCTTTCTAGGACTCCCATTACGACTAAAAACTGATAAATGGACTTGCTGATACTGGCAAATGATTAAAAAATTTTT

GAAGTTTATGGAATATTAATCATGCTACTGAACTCCCTTACAGTTGACAGTATCAAACTATTGTAAAACAGCACAATTCAATACTCAAATTACAAATTTG

AATTCCCACATCTTACTTTTAGCTAGGCTAACTCTAAATTTTTTCACTTTAGAGCCGAGCAATGGTGGCACACGCCTTTAGTCCCAGCACTTGGGAGGCA

GAGACAGGCAGATTTCTGAGTTCGAGGCCAGCCTACAACTGAGTGAGTTCCAGGACAGCCAGGGCTACACTGAGAAACCTGTCTTGAAAAAAATTAATTA

ATTAATTAATTAAAATTTTTTTTCACTTTAAAAGAGAGTGCTTTTTCTACTTCCAAAAAAATTTTGCCCAAGGGAGACACTACCTAGAGTATATATTTAA

AACAAAAACAAAACCAAAAACCCACAAAAAGCAAAAAACCTAACAACTAATCAATGGGAAATGCCCGGTGTCCTGCCATCGAGGCGAGGTTATGCTTATG

TCTTCCAGAAAATGAAGTCCCAGATGGCTCCTGCTGTGACATTTCAGACAAGGACTGCATCCCAGAGACCACCAGACAAGCAAGGGGTTGAAGCTAGACG

ACAAACCCATCAAGAGGAGACGTCCCAAGAGGACAAGGAAGCCAATAACGTGGAGAGACTTAACTGGTCAAGCCAAGACTTTGGGGAAGCAAGAAGGACC

TGATACTGCTGACCCCAAAATGATGCTGTTATGTTTACTGACTGTATTTCATGTTGATTCTCAGCCTGTCGGTGCAGAATCCAAATGCCTTTTGTCAAAA

GGAGGGATAAAGGGTGCACCTGTAATAGGACACAGTATAACATTGTATTGCTGTGCTAATCATTGTTTTTATTCTTTGGGACCAGCTGTCCAGGCAAAAA

GAAGAGTATCCAAACATTTAGACACATGAATGGGTGGCAGCTTGGTTAGACTAACTGAGTCGTTCAAATGTAATAATACAGATTTTAGCTTAATGCAGAA

CTCTTTAGAAAGCTCAGATGGAAGAAATTATAGTTGTATGGAAATGAGAAAGGGAATAAGTGATGTATGGCTTGCTACGATTCAACCAACACCAGTTACT

AAGTAGGGTTGAGTGGGGCTGCCTTCTTGTCTCCAGGCGAATCATTACATTAGTCTGCTGGCCTTGGTGGAGGAAGTATGCCACTGAGGGAGGGGAGAGC

CTTGAGAGTTTAAAAGCCTCGCCTTGCTTCCAGTGTAGTCTCTGCTCTAAGCTTGACCTTCAAGGTGTGATTGCTCAGTTTCATGCCCCTGCCACCATGC

CTGCTGTGTGCTCTCATGCCTTACCGCTGTAATGGACTCACCTCTCTTCTGGAACCACAAAATAAACACTGTCTTCCTTAA
Translation
 - UNI17468 - MSLCRKALLTPRMTTQNLRQPTPLSPLSALTGGCHHPGSKYPE ELTAWCRGDMRGVSVQLGSSWTTALPR RNVLPNISVERPES

MTISQ 

For any suggestions or comments, please send an email to unitrap@crg.es