Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044390 (Tigd3)
Chromosomal location
Chr 19: 5891139 - 5894107 (-)
Description
tigger transposable element derived 3 Gene [Source:MGI Symbol;Acc:MGI:2681860]
Human Ortholog
not available
Omim not available
UniTrap UNI35463
Vector Insertion
Chr 19: 5891138 - 5894108
Public Clones IST14580C6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055911
Sequence
CGCTCTGCGCGCGCCCGCTCCAGAGCAGCCTCTCGGCGCGCTCTGTCCTCGGGTCGCGGCGCCCGTCACTCTCTGGTTCTGCTGAGGCCCAGGAACCTGG

CTGGGGCAGGGACTGGAGGCGCGGGACGGCGCCTGGAG - UNI35463 - CTTCCCAGGGAGTCATGGAGCTGAACACCAAGAAGAAGCTTCACGCCC

TGTCCCTGGCTGAGAAGATCCAGGTGCTGGAACTCTTGGATGAGTCTAAGATGTCCCAGTCAGAGGTGGCCCGGCGCTTCCAGGTCTCACAGCCCCAGAT

CTCACGGATCTGCAAGAATAAGGAGAAGCTGTTGGCAGACTGGTGCAGTGGCACAGCCAACCACGAGCGGAAGCGGAAGCGTGAATCCAAATACAGTGGG

ATCGATGAGGCTCTACTGTGCTGGTACCACATTGCCCGAGCCAAGGCCTGGGATGTAACGGGGCCCATGTTGCTCCACAAGGCCAAGGAACTGGCCGATA

TCATGGGCCAGGATTTCGTGCCTAGCATTGGCTGGCTGGTCCGCTGGAAACGTCGAAACAATGTGGGCTTTGGGACTCGCCAGGTCCTTGTCCCTCTGTT

CCCTCCTGAAGCTCCTCCTGCAGTTCTCCCATCTCAGGCCCAGCCACCTCTTTCTCTTAAAGACTTCTCACCAGAAGATGTTTTTGGCTGTGCTGAAGTA

CCCTTGTTGTATCGCGCGGTGCCTGGCAGAGTGTTTGAATGTGATCGGTTGCAAGTACTGTTATGTGCCAACAGCAGAGGCACAGAAAAGCGAAGGGTAT

TTGTGGGTGGGCTCCAGGCGGCCCCAAGATGCTTCTTTGGGGTGAGCAGTGAGGCACTGCCTACCTCTTATCACCCTGACCTAGCCATTCCCTGGTCAGA

GTGGCTGGCACAGTTTGACCAGGACATGGGACAGCAGGGCCGACAGGTAGCCTTGCTACTGGCTTCTGGAGTGGTAGAGGAATGGGCCAGCCTTCCTGGA

CTCCATCACGTTCGACTCCTGCCTCTCTCTGCCTCCAGCACCACTCCTTCCCTGCCTGGCTCTGTGATTTTGGCCTTTAAGGCCCATTACCGTCACCGTC

TACTGAGCAAACTGGCTGCCATGCAGAGTGGGAAAGAGGGCACCTCCCTGGCGGAGGCCAGGGCTAGCATCACAGTTTTGGATGCTCTGCACATGGTGGC

CGCAGCTTGGGCCAAGGTACCTCGCCAGCTCATTTTGAGCAGCTTTGTTCAAGAAGGGCTCGCTCCGGGCAAAACACCACTGTCCCTGGACAAAGACACT

GAGATGTCACCAGTCCCTAGTGGGCTGAGCCAAGAGGAGTTTTCTCACTTTGTGGACCTGGAGGATGAGGACCCAGGGCCTAGAGTGTGCAAAGAGGAGA

CGGGTACTGAAGACAGTGGGAGGGAAGAAGATGGCTTTGAGCCCCTGCCCACCAAAGCCGATGCCCTGCAGGCACTGTGCACCCTGAGGAGGTGGCTTGA

ATGCAACAGTGCCTCTCCAGAACTCTTTGAGAAATTCTATGACTGTGAGGTGGAGGTGGAGCAGCTCTGCTGTCTGTGAGGAGGCATAGCTGCCTATTAG

TCTCCCTCTCCTGTTTCCCATGGAAACGCCTCTCCAGAGACAGACTGGCTCTTTCCTGTGGAAATAGTATGTGGAGGGTGTAGAAGGGAAGGAAGTTGGA

ACACAAAGTCTAAGGTCAGAGTAAAAGTTGTTCAGGCCTAGAGTTTCTACGGATGGGGCCTCAAGAGTGGAAAGCTGGGCTGTGTAGCTTCTAGGCCCTG

GAGAAACTTCTAGAGCTTTGTGGAGAGTTAGTCTAAATAGGGTAGAACCTAGAAAGGTGGACCGACTTCCTTTTTTTGTTTTTTGTTTTTTTTTTTTCTT

TGAGACAGGGTTTCTCTGTGTAGCCCTGGCTTTCCTGGAACTCACTTTGTAGACCAGGCTGGCCTTGAACTCAGAAACCCGCCTGCCTCTGCCTCCCAAG

TGCTGGGATTAAAGGTGTGCACCACCATCGCACAGCATGGACAGACTTCCTAACAGTGGCCCCATTCCTTGAATTTTTGTGTCAAAACCAATTCTGCTTC

AGGAAATAAAGTTTTTAGCCACAAAGTC
Translation
 - UNI35463 - MELNTKKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKNKEKLLADWCSGTANHERKRKRESKYSGIDEALLCW

YHIARAKAWDVTGPMLLHKAKELADIMGQDFVPSIGWLVRWKRRNNVGFGTRQVLVPLFPPEAPPAVLPSQAQPPLSLKDFSPEDVFGCAEVPLLYRAVP

GRVFECDRLQVLLCANSRGTEKRRVFVGGLQAAPRCFFGVSSEALPTSYHPDLAIPWSEWLAQFDQDMGQQGRQVALLLASGVVEEWASLPGLHHVRLLP

LSASSTTPSLPGSVILAFKAHYRHRLLSKLAAMQSGKEGTSLAEARASITVLDALHMVAAAWAKVPRQLILSSFVQEGLAPGKTPLSLDKDTEMSPVPSG

LSQEEFSHFVDLEDEDPGPRVCKEETGTEDSGREEDGFEPLPTKADALQALCTLRRWLECNSASPELFEKFYDCEVEVEQLCCL

For any suggestions or comments, please send an email to unitrap@crg.es