Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044393 (Dsg2)
Chromosomal location
Chr 18: 20716608 - 20761308 (+)
Description
desmoglein 2 Gene [Source:MGI (curated);Acc:Dsg2-001]
RefSeq_dna
NM_007883 
RefSeq_peptide
NP_031909.2 
UniGene
Mm.345891 
MGI
MGI:1196466 
Uniprot/SWISSPROT
O55111 
Uniprot/SPTREMBL
Q8VCE3 Q811I1 A2RRJ0 Q8BK55 
Human Ortholog
ENSG00000046604 (DSG2)
Omim 610193 - ARRHYTHMOGENIC RIGHT VENTRICULAR DYSPLASIA, FAMILIAL, 10  
UniTrap UNI16186
Vector Insertion
Chr 18: 20716846 - 20731989
Public Clones IST14568E8 (tigm)
Private Clones OST465431 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7873
Vector Insertion
Chr 18: 20752793 - 20754460
Public Clones RRJ037 (baygenomics) XST040 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121837
Sequence
CGGCGAGGCCCGGAGGCGAGGGCGCGGCGGATCGAGGCGATGGCGCGGAGCCCGGGTGACCGGTGCGCCCTGCTGCTGCTGGTGCAGCTGCTGGCGGTG 

- UNI16186 - GTCTGCTTGGACTTTGGAAACGGACTTCACTTAGAG GTCTTCAGCCCAAGAAATGAAGGCAAACCGTTCCCTAAGCACACTCACTT

GGTTCGTCAAAAGAGGGCCTGGATCACTGCCCCTGTGGCTCTGCGGGAGGGCGAAGACCTGTCCAGAAAGAACCCGATTGCCAAG ATACACTCTGACCT

TGCAGAAGAAAAAGGGATAAAAATCACGTACAAGTACACTGGGAAGGGAATTACAGAACCGCCTTTCGGCATATTCGTCTTTGATAGAAACACAGGAGAA

CTGAACATCACTAGCATTCTTGACCGGGAAGAAACACCATATTTTCTG CTGACAGGCTATGCATTGGACTCCAGAGGAAACAACCTGGAAAAGCCCTTG

GAACTACGCATCAAAGTTCTGGACATCAATGACAACGAGCCAGTGTTCACACAGGAGGTCTTTGTTGGGTCCATTGAGGAATTGAGTGCAGCAC ATACA

CTTGTGATGAAAATCACCGCCACAGATGCAGATGACCCGGAGACTCTGAATGCTAAAGTCTCCTACAGAATTGTCTCTCAGGAGCCTGCAAATAGTCATA

TGTTCTACCTAAATAAAGACACGGGGGAGATCTATACGACCAGTTTTACTTTGGACAGAGAG GAACACAGCAGCTATTCCTTGACGGTGGAAGCAAGAG

ATGGTAACGGGCAGATAACAGACAAGCCAGTCCAGCAAGCTCAAGTTCAGATCCGTATATTGGATGTCAATGACAATATACCTGTGGTAGAAAACAAAAT

GGTAACTCAGTTTTATAGTAGACTTACTATTTCCTGAATCACAACTAAAATTACATTATTGCATTAATAAAA
Translation
MARSPGDRCALLLLVQLLAV - UNI16186 - VCLDFGNGLHLE VFSPRNEGKPFPKHTHLVRQKRAWITAPVALREGEDLSRKNPIAK IHSDLAE

EKGIKITYKYTGKGITEPPFGIFVFDRNTGELNITSILDREETPYFL LTGYALDSRGNNLEKPLELRIKVLDINDNEPVFTQEVFVGSIEELSAAH HT

LVMKITATDADDPETLNAKVSYRIVSQEPANSHMFYLNKDTGEIYTTSFTLDRE EHSSYSLTVEARDGNGQITDKPVQQAQVQIRILDVNDNIPVVENK

MVTQFYSRLTIS
Transcript ENSMUST00000120102
Sequence
CCCGGGCACACCTGGAACCGCACCCCGGGTCCCGCAGAGTCAGAGAAGGGCGGCCCCGGGAGGGACCTGCCCAGGAGGATCCGCAGGGCGCCGGCGAGGC

CCGGAGGCGAGGGCGCGGCGGATCGAGGCGATGGCGCGGAGCCCGGGTGACCGGTGCGCCCTGCTGCTGCTGGTGCAGCTGCTGGCGGTG - UNI1618

6 - GTCTGCTTGGACTTTGGAAACGGACTTCACTTAGAG GTCTTCAGCCCAAGAAATGAAGGCAAACCGTTCCCTAAGCACACTCACTTGGTTCGTCA

AAAGAGGGCCTGGATCACTGCCCCTGTGGCTCTGCGGGAGGGCGAAGACCTGTCCAGAAAGAACCCGATTGCCAAG ATACACTCTGACCTTGCAGAAGA

AAAAGGGATAAAAATCACGTACAAGTACACTGGGAAGGGAATTACAGAACCGCCTTTCGGCATATTCGTCTTTGATAGAAACACAGGAGAACTGAACATC

ACTAGCATTCTTGACCGGGAAGAAACACCATATTTTCTG CTGACAGGCTATGCATTGGACTCCAGAGGAAACAACCTGGAAAAGCCCTTGGAACTACGC

ATCAAAGTTCTGGACATCAATGACAACGAGCCAGTGTTCACACAGGAGGTCTTTGTTGGGTCCATTGAGGAATTGAGTGCAGCAC ATACACTTGTGATG

AAAATCACCGCCACAGATGCAGATGACCCGGAGACTCTGAATGCTAAAGTCTCCTACAGAATTGTCTCTCAGGAGCCTGCAAATAGTCATATGTTCTACC

TAAATAAAGACACGGGGGAGATCTATACGACCAGTTTTACTTTGGACAGAGAG GAACACAGCAGCTATTCCTTGACGGTGGAAGCAAGAGATGGTAACG

GGCAGATAACAGACAAGCCAGTCCAGCAAGCTCAAGTTCAGATCCGTATATTGGATGTCAATGACAATATACCTGTGGTAGAAAACAAAATG TATGAGG

GGACAGTGGAAGAAAACCAGGTCAATGTAGAAGTCATGCGGATCAAAGTGACCGATGCAGATGAAGTGGGCTCTGATAACTGGCTAGCAAACTTTACATT

TGCATCAGGAAATGAAGGGGGCTATTTCCACATTGAGACTGACACACAGACTAATGAAGGGATTGTGACCCTTGTCAAGGTAAGTTGTAAATGTCCACCA

CCAGGGTGGGACTGTGGTTATAGGAAAGACTAACATGCTTTGAGTCCCATACTCTCACAGGTGCTTTACAGGGACGGACATCAGTTGGTACCAGCATTGC

TCAGAATCAGGAACAGCCTTCATAGCACAAGTCATATAGAAAGAAGCAGTTACACTACAGTTCAGAGTCAGATCAGGAACTCAGATCCCAGGCACACAAC

CTTGCATAGCACACTTCCAAGCAGTGTGAGCTTGATGGGCCAGGGCTCAGTTACTTGCCTTTCAGAGAAAAATCTATTGTGATTTTACTTGCAAGTATTG

TAAGGGCTGCAGTTTGAAAGGAAGTAACCTGCTCTCCTGTGCCTCCTGATTATCAATGAAGGCAAAATTGAATTAAGTAGTCGTGCTGAACATATGAAAT

TCAGGGTATAGCTCAGTGGTAGATGGCTTGCCTAGCATGTGTAAGGTCCTGGGTTCAACCCCCAGTGCCAAATAAGTTAAAATTTGGCTGGATATAGTGA

CTTGTACATATAATCCCAGCACTTGAAAGGAGGATTGTTGAAAGTCCAAGGACAACCTAGGCTACATTGTAAGCCTGGGTTATAAAGTGAGACCTCTAGC

CAATCAATGGCCATGGATGAACTGGGTTTACCTGAAAGGGGGGCTGGAAATGAAAGAGACAGGGGGCGGGGCTAGAGAAGGATGAAGCCAAGACAAGGTT

CTGGTCAAGGCTCCAAGTTTAATATTCAGCACTGTGTTTATATAGGGAAAGCCCACAGACCCATCCTTTGTTTCAGCTGGTTTATGTTGCAAAGCAAGAT

CAGCAGGGAGTTTATAATTCTAAGTTCCTGTAGGAAAGTGCACATGCAACAAAGGCAGATGACTCCACCTAAGTCATTAAGGTTCAATGTGGCAAACGCT

CAAGGTCTGCTCACCCTGCTCAAGGCCGAGAAAAGAGAACAATTCTCCCTTTTTTTGTTTTTTAAAGATGAGCAGTAACAGTAACTGGACAGGGGCACAA

GATTTACTTGTTTTCTATAATCACATCTAGGGTAAAGAGTGGCCCAGTGACTGTTCCTGTCTTAGGTCAGTGTCTATATTGCTCCTTCTTACCCGTCATG

GAGAACAAACATAGCATTGATATATGACTTTGCCTTAGGTCGATAGGAGGTCAAGAACACTCTTACCTGTCTCTGACTACAGGCTTTCTATAGCACACTC

TTTCCCATTCGGACCAAAGCCATGAAGGACATGTGACTATGCACTCAATGCATTTCTTCATAGCAATTGATAACTGTCATGGTGAATAGCTGAGCTTCCT

GAAAGGGATCCTCTGTGAAGGCAACCAATCTGTTTAAGATACAAGGTCCAGTAGTTAAAAGCAACAGATTATAATTAATGATCAAAGCAGTGTAGAAATC

AAGGTTGTAAGCCCTGGGGAAGTGGAAAACCAGGACTCAAACCATCCCTGATTCTGTCCTTTTTCTCTTTTCCTTTTGGCTAGTTCTTCTCGAACTTTAG

CCATAGAATCCTTTACTATTCCTGAATTATCAATGTAAAAGTAACATTCTTCATGGAGGGCTGTGCGTAGTCCTCCTTGTTGAAGGAATAAAAGATCAAG

TCCTCTCCTGTTTTGAAGGACTACCTCAGACAAGGAGGTTAGAGATTCTTATAAATGGGAAATAGAGGTTTCTATCTTTTCTATATCTGTATCTATTGCC

ATTCTAATGCACTCATATTTTTTTTTCTTGCAAAACCAGGGCAGAAGTGCTAGTAGCTTCTCCTCCCACACTCAGATTACCTTGTCATCCAAATTTTAAA

TTTTTAAAATAAAAAGCATGATTTAAATGATTTTGTGGTATATTCAGATATAGTTCCCCTTTTTTGTCTTTTATGAAGATATTGTTTTATGAAGATAAGT

TCCATGGGTCTGTTCCACAATATCTTGTCCTTTAGGATAATAAGAAAATATGGGTAACATCCATTTGCCATAATTGGTTAGGTACAAGTCCTCGAAGATT

AACACTATTATATGGTACACGAAGAGACTGAGGACGCTGAGAGCAAGTCTTTACAACTTGATGTGCATATTTTCTAGAAATACCAAATTGTTGTCTCAAA

CTGTTACTATTTTGATGATGTAAAGAATGAGAGTGTTCAGCTAAGTGTTCCTGTAAGGCCTATAAACTGCCTGATATACAAAACTGCTATACCATTTTCC

AGGGGTCCAGGCAATCCAGTATGAGCTCTTAAATGTCCTATAAAGTAAGGAGCAGTACATATTTCTCAAATTAAGCCATATTTGTATAAATAACTGTAAA

AATTGAGAATTAGCAGTATCTAAAAAAGGAACAATTTCAAGCAATTGTAAACCATGAGCTATATATTGGCTATCAGTATACAAATTAAAAACTTGTTTTT

TGAGCATTTT
Translation
MARSPGDRCALLLLVQLLAV - UNI16186 - VCLDFGNGLHLE VFSPRNEGKPFPKHTHLVRQKRAWITAPVALREGEDLSRKNPIAK IHSDLAE

EKGIKITYKYTGKGITEPPFGIFVFDRNTGELNITSILDREETPYFL LTGYALDSRGNNLEKPLELRIKVLDINDNEPVFTQEVFVGSIEELSAAH HT

LVMKITATDADDPETLNAKVSYRIVSQEPANSHMFYLNKDTGEIYTTSFTLDRE EHSSYSLTVEARDGNGQITDKPVQQAQVQIRILDVNDNIPVVENK

M YEGTVEENQVNVEVMRIKVTDADEVGSDNWLANFTFASGNEGGYFHIETDTQTNEGIVTLVKVSCKCPPPGWDCGYRKD
Transcript ENSMUST00000059787
Sequence
CCCCTCCTCCATCTAGGCTGTGGCCCGGCCCAAGGCTACCCTTTCTGACCCGGGCACACCTGGAACCGCACCCCGGGTCCCGCAGAGTCAGAGAAGGGCG

GCCCCGGGAGGGACCTGCCCAGGAGGATCCGCAGGGCGCCGGCGAGGCCCGGAGGCGAGGGCGCGGCGGATCGAGGCGATGGCGCGGAGCCCGGGTGACC

GGTGCGCCCTGCTGCTGCTGGTGCAGCTGCTGGCGGTG - UNI16186 - GTCTGCTTGGACTTTGGAAACGGACTTCACTTAGAG GTCTTCAGCCC

AAGAAATGAAGGCAAACCGTTCCCTAAGCACACTCACTTGGTTCGTCAAAAGAGGGCCTGGATCACTGCCCCTGTGGCTCTGCGGGAGGGCGAAGACCTG

TCCAGAAAGAACCCGATTGCCAAG ATACACTCTGACCTTGCAGAAGAAAAAGGGATAAAAATCACGTACAAGTACACTGGGAAGGGAATTACAGAACCG

CCTTTCGGCATATTCGTCTTTGATAGAAACACAGGAGAACTGAACATCACTAGCATTCTTGACCGGGAAGAAACACCATATTTTCTG CTGACAGGCTAT

GCATTGGACTCCAGAGGAAACAACCTGGAAAAGCCCTTGGAACTACGCATCAAAGTTCTGGACATCAATGACAACGAGCCAGTGTTCACACAGGAGGTCT

TTGTTGGGTCCATTGAGGAATTGAGTGCAGCAC ATACACTTGTGATGAAAATCACCGCCACAGATGCAGATGACCCGGAGACTCTGAATGCTAAAGTCT

CCTACAGAATTGTCTCTCAGGAGCCTGCAAATAGTCATATGTTCTACCTAAATAAAGACACGGGGGAGATCTATACGACCAGTTTTACTTTGGACAGAGA

G GAACACAGCAGCTATTCCTTGACGGTGGAAGCAAGAGATGGTAACGGGCAGATAACAGACAAGCCAGTCCAGCAAGCTCAAGTTCAGATCCGTATATT

GGATGTCAATGACAATATACCTGTGGTAGAAAACAAAATG TATGAGGGGACAGTGGAAGAAAACCAGGTCAATGTAGAAGTCATGCGGATCAAAGTGAC

CGATGCAGATGAAGTGGGCTCTGATAACTGGCTAGCAAACTTTACATTTGCATCAGGAAATGAAGGGGGCTATTTCCACATTGAGACTGACACACAGACT

AATGAAGGGATTGTGACCCTTGTCAAG GAAGTGGACTATGAAGAAATGAAGAAGCTAGACTTGAGCATCATTGTCACTAACAAAGCAGCTTTCCACAAG

TCCATTCTGAGCAAGTACAAGGCCACGCCCATTCCCATCACTGTCAAGGTCAAGAACGTGGTTGAAGGCATTCATTTCAAGAGCAGCGTAGTCTCTTTCC

GAGCTAGTGAGGCAATGGATAGATCCAGCCTCAGCAGGTCGATTGGAAATTTTCAAGTTTTTGATGAAGACACTGGTCAAGCAGCTAAAGTAAC ATATG

TAAAAGTGCAAGACACTGACAACTGGGTCTCTGTGGACTCCGTCACTTCAGAGATTAAGCTTGTAAAGATTCCTGACTTTGAATCTAGATATGTCCAAAA

TGGTACCTACACTGCAAAGGTTGTGGCCATATCCAAAG AACATCCTCAAAAAACCATCACTGGCACCATCGTTATCACTGTTGAAGACGTCAATGACAA

TTGTCCCGTGCTGGTGGACTCTGTACGGAGTGTCTGTGAGGATGAACCATATGTGAATGTCACTGCAGAGGATTTGGATGGGGCCCAGAACAGTGCGCCA

TTCAGCTTCTCCATCATTGACCAGCCTCCTGGAACGGCACAGAAGTGGAAAATAACGCACCAGGAAA GTACCAGTGTGCTGCTGCAGCAGAGCGAGCGG

AAACGCGGGAGAAGTGAGATTCCCTTCCTCATTTCCGACAGCCAGGGCTTCAGCTGCCCCGAAAGGCAGGTCCTTCAGCTCACTGTATGCGAGTGTCTGA

AGGGCGGTGGCTGTGTGGCTGCACAGTATGACAACTACGTCGGGTTGGGCCCTGCCGCCATCGCTCTCATGATTCTAGCACTCCTGCTCCTGCTCC - U

NI7873 - TGGTGCCGCTCTTGCTGTTGATATGCCACTGTGGAGGGGGCGCCAAAGGCTTCACCCCCATTCCTGGGACAATAGAGATGCTGCACCCTTG

GAATAATGAAGGGGCACCTCCTGAGGACAAG GTGGTGCCATCGCTTCTGGTGGCCGATCATGCAGAGAGCTCGGCAGTGAGAGGCGGCGTAGGAGGTGC

GATGCTCAAGGAAGGCATGATGAAAGGCAGCAGCTCAGCTTCCGTTACCAAAGGGCAGCATGAGCTGTCTGAGGTTGACGGAAGATGGGAAGAACACAGA

AGCCTCCTCACCGCTGGGGCCACTCACCATGTAAGGACAGCAGGAACCATCGCTGCCAACGAAGCCGTAAGGACAAGAGCCACGGGGTCTTCCAGAGACA

TGAGTGGGGCTCGAGGAGCCGTTGCCGTGAATGAGGAATTCTTAAGAAGTTACTTCACAGAG AAAGCGGCCTCCTACAATGGGGAAGACGACCTTCACA

TGGCCAAAGACTGCCTTCTCGTTTACTCTCAGGAAGACACGGCCTCCCTCCGAGGCTCGGTCGGGTGCTGCAGTTTCATCGAGGGAGAACTCGATGACCT

GTTCCTGGATGATCTTGGCCTTAAATTCAAGACCCTAGCTGAAGTTTGCCTAGGTCGAAAGATCGATCTGGATGTGGACATTGAACAGAGGCAGAAGCCG

GTCAGAGAAGCGAGCGTGAGTGCAGCTTCTGGCTCGCACTATGAGCAAGCGGTAACCAGCTCAGAGAGCGCGTACTCCTCTAACACCGGCTTCCCCGCCC

CCAAACCTCTGCACGAAGTGCACACAGAGAAAGTCACACAGGAAATCGTCACTGAGAGCTCTGTATCTTCCAGGCAGAGTCAGAAGGTAGTACCGCCACC

TGATCCTGTGGCTTCTGGTAATATTATAGTGACGGAAACTTCCTATGCCAAAGGCTCAGCAGTGCCACCCAGCACTGTGCTCCTGGCTCCCAGACAGCCA

CAGAGCCTGATCGTGACAGAGAGGGTGTATGCTCCAACCTCCACCTTGGTGGATCAGCATTATGCCAATGAAGAAAAAGTCCTTGTTACCGAACGAGTGA

TCCAGCCTAATGGGGGCATCCCTAAGCCCCTTGAGGTCACCCAGCATCTGAAAGATGCACAGTATGTAATGGTGAGGGAAAGAGAGAGCATCCTTGCTCC

CAGCTCAGGCGTGCAGCCCACTCTGGCAATGCCCAGCGTGGCAGCAGGAGGACAGAATGTCACCGTGACAGAAAGAATACTAACTCCTGCTTCCACTCTG

CAGTCCAGCTACCAGATTCCCAGTGAAACCTCCATCACGGCTAGGAACACTGTGCTCTCTAGTGTGGGAAGCATAGGTCCTCTGCCCAATTTAGATCTAG

AGGAATCTGATCGTCCCAATTCTACTATAACCACATCTTCCACCAGGGTCACCAAGCATAGCACCATGCAACATTCTTACTCCTAAAGAGAAGCCAGCCG

CAGTCGGATCTGGACCTTAACTAGCATCCACTGGATGTGTGTGTCCATGCCCCTAATGTTATAACAGCCACACAAGACTTGCACATTGGAAAAACTTATT

GACATGCCAAACAAAGACACCATGTCTCAGGTAGGGTTGTATTTCAGCAATGCTCTGTGATTATTGGGGGATGGAGTTAAGATGCTAGTTCCTCAGTGCC

TTTTAGAGTACTGTGCAAGCAATACTCGCAAACAGGACATGTAAAATTGAGTTCCAAGAACTTACAAAACTAAAGCAGGGTATCTAATTCATCAGGTCCA

GGAGGCTGGGTCTCTGCACAATGCATTGATATTCAGCAGGGACAGTTCCACCCCTTATATTACAGAGCCACACAGGTTATAGGTACCAAATAGCTCATCC

ACCCAGAGACACATCTCCACTCTTTCATCTCCACTGGAACCCTGAGTACACCAGAGGG
Translation
MARSPGDRCALLLLVQLLAV - UNI16186 - VCLDFGNGLHLE VFSPRNEGKPFPKHTHLVRQKRAWITAPVALREGEDLSRKNPIAK IHSDLAE

EKGIKITYKYTGKGITEPPFGIFVFDRNTGELNITSILDREETPYFL LTGYALDSRGNNLEKPLELRIKVLDINDNEPVFTQEVFVGSIEELSAAH HT

LVMKITATDADDPETLNAKVSYRIVSQEPANSHMFYLNKDTGEIYTTSFTLDRE EHSSYSLTVEARDGNGQITDKPVQQAQVQIRILDVNDNIPVVENK

M YEGTVEENQVNVEVMRIKVTDADEVGSDNWLANFTFASGNEGGYFHIETDTQTNEGIVTLVK EVDYEEMKKLDLSIIVTNKAAFHKSILSKYKATPI

PITVKVKNVVEGIHFKSSVVSFRASEAMDRSSLSRSIGNFQVFDEDTGQAAKVT TYVKVQDTDNWVSVDSVTSEIKLVKIPDFESRYVQNGTYTAKVVA

ISKE EHPQKTITGTIVITVEDVNDNCPVLVDSVRSVCEDEPYVNVTAEDLDGAQNSAPFSFSIIDQPPGTAQKWKITHQES STSVLLQQSERKRGRSE

IPFLISDSQGFSCPERQVLQLTVCECLKGGGCVAAQYDNYVGLGPAAIALMILALLLLLL - UNI7873 - LVPLLLLICHCGGGAKGFTPIPGTIEM

LHPWNNEGAPPEDK VVPSLLVADHAESSAVRGGVGGAMLKEGMMKGSSSASVTKGQHELSEVDGRWEEHRSLLTAGATHHVRTAGTIAANEAVRTRATG

SSRDMSGARGAVAVNEEFLRSYFTE KAASYNGEDDLHMAKDCLLVYSQEDTASLRGSVGCCSFIEGELDDLFLDDLGLKFKTLAEVCLGRKIDLDVDIE

QRQKPVREASVSAASGSHYEQAVTSSESAYSSNTGFPAPKPLHEVHTEKVTQEIVTESSVSSRQSQKVVPPPDPVASGNIIVTETSYAKGSAVPPSTVLL

APRQPQSLIVTERVYAPTSTLVDQHYANEEKVLVTERVIQPNGGIPKPLEVTQHLKDAQYVMVRERESILAPSSGVQPTLAMPSVAAGGQNVTVTERILT

PASTLQSSYQIPSETSITARNTVLSSVGSIGPLPNLDLEESDRPNSTITTSSTRVTKHSTMQHSYS

For any suggestions or comments, please send an email to unitrap@crg.es