Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044433 (2310057J16Rik)
Chromosomal location
Chr 8: 3587676 - 3609047 (+)
Description
RIKEN cDNA 2310057J16 gene Gene [Source:MGI Symbol;Acc:MGI:1916947]
RefSeq_dna
NM_027171 
RefSeq_peptide
NP_081447.1 
MGI
MGI:1916947 
Uniprot/SWISSPROT
Q80VC9 
Human Ortholog
ENSG00000076826 (KIAA1543)
Omim not available
UniTrap UNI36319
Vector Insertion
Chr 8: 3587960 - 3597841
Public Clones CMHD-GT_496E9-3 (cmhd) (cmhd) IST10061F10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32090
Vector Insertion
Chr 8: 3598809 - 3598892
Public Clones IST10797F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14651
Vector Insertion
Chr 8: 3598989 - 3600675
Public Clones FHCRC-GT-S3-4D1 (fhcrc) IST12057F8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 17% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33057
Vector Insertion
Chr 8: 3600815 - 3601965
Public Clones IST14465A1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30335
Vector Insertion
Chr 8: 3602426 - 3602553
Public Clones CMHD-GT_410C1-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27805
Vector Insertion
Chr 8: 3607891 - 3608188
Public Clones not available
Private Clones OST47641 (lexicon)
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000111066
Sequence
ATTAGTAACAGCAGCAGCCGCGGCGGCAACCCGATTCGGGGTGGCGGAGGCTCGGCAGCAGCGCAGCGCAGCGCAGCGCACGCAGCCCAGCCCATCAGAG

CGCGCGGACCCGGGCGGCCGTAACCCCGGCGTCGCCATGGTGGAAGCGGCGCCCGCAGGGTCCGGGCCACTGCGGAGGACTTTCCTGGTCCCCGAGATCA

AGTCTTTGGACCAGTACGATTTCTCTCGAGCCAAGGCGGCGGCGAGTCTGGCGTGGGTGCTGCGGGCCGCATTCGGGGGAGCAG - UNI36319 - AG

CATGTGCCTCCGGAGCTGTGGGAACCCTTCTACACCGATCAGTACGCACAGGAGCACGTGAAGCCCCCAGTGACGCGGCTGCTGCTCTCTGCGGAACTAT

ACTGTCGGGCCTGGCGCCAGGCACTGCCACAGCTCGAGCCATCCCCCAGTCCCTCTGCTCTGTTGGCCTTGCTGGCGAGGAGGGGCACGGTGCCTTCACT

GCCTGAGCACCCAGTGCGCGAGGCTGACCTGAAACACCAGCCAATTCTCATG GGAGCCCACCTAGCTGTCATCGATGCTCTCATGGTTGCCTTCTCATT

TGAGTGGACAAAGACACTACCTGGTCCCTTGGCTCTGAGCAGCTTGGAGCACAAACTCCTTTTCTGGGTAGACACA - UNI32090 - ACTGTTCGGC

GGCTGCAGGAGAAGACAGAACAAGAAGCAGCCCAGCGTGCATCTCCTGCAGCCCCTCTGGATGGGGCCTCTCCTGCCCAGCCCTCG - UNI14651 - 

ATTCGATATCGCAAGGACCGTGCCATTGCCCGAAGGGCTCCCTGCTTTCCAAATGTGACTACCCTTCAGGACCTGGCCAGTGGGGCAGCACTGGCTGCCA

CCATCCACTGCTATTGTCCCCAGCTATTACGACTTGAGG - UNI33057 - AGGTGTGCCTCAAGGACCCCATGTCTGTGGCAGACAGTCTATACAAC

CTCCAGCTGGTGCAAGACTTCTGTGCCTCCCATCTTCCTCGAGGCTGCCCCCTGTCCCTTGAAGACTTGCTGTATGTCCCACCACCCCTCAAG GTCAAC

CTGGTGGTGCTGTTGGCTGAGATGTATATGTGCTTTGAGGTTCTGAAGCCTGATTTTGTGCAGGCCAAAGACTTGCCTGATGGACATG CTGTCTCCCCC

CGGAATACAGAGACTGTTCCATCTCAGAACAACAGTGGCAGCAG - UNI30335 - TTCTCCTGTCTTCAACTTCCGTCACCCACTTCTGTCACCTGG

TGGTCCCCAGTCTCCACTCCGAGGATCCACAG GCTCCCTGAAGTCCTCTCCATCAATGTCTCACATGGAGGCTCTTGGCAAAGCCTGGAACCGTCAGCT

TAG CCGTCCCCTCTCCCAGGCTGTGTCGTTCAGCACTCCCTTTGGCCTGGACAGCGATGTGGATGTCGTCATGGGAGATCCTGTCCTGCTCCGCTCCGT

CAGCTCAGACAGTCTGGGTCCTCCACGTCCTGTGTCAACATCATCCCGGAATTCTGCTCAGCCAGCCCCAGAATCTGGAGACCTACCCACGATTGAAGAG

GCCCTGCAGATCATTCACAGTGCTGAGCCCCGACTGCTCCCTGATGGGGCTGCTGATGGCAGTTTCTACCTCCATTCTCCTGAGGGTCTCTCCAAACCAC

CACTCTCCCCCTACCCTCCCGAAGGAGCCTCAAAGCCGCTGTCTGATAGGCTCAACAAGGCGCCTATCTATATATCACACCCTGAGAACCCTTCAAAATC

ATCTCCCTGCTCAACAGGAGAGATACTGAAACCACCACCCCCATCCGAGGGTTCCCCCAAAGCTGTGGCTTCATCCCCAGCAGCCAACAACTCCGAAGTG

AAGATGACCAGTTTTGCTGAACGCAAGAAACAGCTGGTGAAGGCTGAGGCTGAGTCAGGATTGGGGTCTCCAACATCCACCCCCGTAGCACCTGAGGCCT

TGAGCTCAGAGATGAGTGAGCTGGGAGCCAGGCTGGAGGAGAAGCGCCGAGCCATAGAGGCACAGAAACGACGCATTGAGGCAATCTTTGCCAAGCATAG

GCAGAGGCTGGGCAAGAGCGCTTTCCTGCAGGTGCAGCCTCGGGAGGCTGCAGGGGAGGCCGAGGAGGAAGCTGAGCTGGGCTCAGTTCCTGGTGGGGAA

CGGCCAGCAGGTGAGGGCCAGGGTGAGCCGTCCTTACGGCACAAGTCAGTTACCTTCTCTCCAGACCTGGGCCCAGTGCCCCCAGAGGGACTTGGGGATT

ACAATAGAGCAGTCAGTAAGCTGAGTGCCGCTCTGAGCTCTCTGCAGCGGGACATGCAGAGGCTCACAGACCAGCAACAGCGGCTTCTAGCCCCTCCAGA

AGCTCCTGGACCTGCCCCACCACCTGCAGCCTGGGTCATTCCTGGACCCGCCACTGGGCCTAAAGCAGCATCCCCCAGCCCTGCCCGTCGTGCCCCAGCT

GCCCGACGCAGCCCTGGGCCAGGCCCCAGCCCAACACCCCGTAGTCCAAAACATGCAAGGCCGGCAGAGCTGAAGCTTGCACCTTTGACAAGGGTACTCA

CACCACCCCATGATGTAGACAGCCTCCCTCACCTACGCAAGTTTTCACCCAGCCAGGTGCCTGTACAGACTCGCTCCTCTATCCTCCTGTCGGAGGGGAC

ACCTCCCGAGGAGCCCACCACCAAGCCTGCCCTCATTGAGATCCCTCTAGCCAGCCTGGGGGAGCCTGCTGCTGATGAGGAAGGAGATGGGAGCCCCCCT

GGGGCTGAGGATTCCTTAGAGGAAGAGGCATCTTCTGAGGGAGAGCCCCGATCAGGGCTTGGATTCTTTTATAAG GACGAAGACAAGCCTGAGGATGAG

ATGGCTCAGAAGCGAGCTAGCCTGCTGGAGCGTCAGCAGAGGCGGGTAGAGGAAGCCCGGCGGCGCAAACAGTGGCAGGAGGCAGAGAAGGAGCAGAAAC

GGGAGGAGGCCGCCAG GCTGGCTCAGGAGGCTCCAGGCTTGGCCTTTACAACTCCTGTTGTAGCCTCTGCGGCTCCAGTGGCCACCTTGGCTCCTACTA

CCAGAGCCATGGCCCCAGCTGAGGAGGAGGTGGGCCCCCGGCGGGGGGACTTCACAAGACTTGAGTATGAACGCCGGGCACAACTGAAACTGATGGATGA

CCTTGATAAGGTGCTACGGCCCCGGGCCTCAGGGACCGGGGGACCAGGGCGGGGCGGGCGCAGGGCCACCCGGCCACGCTCTGGTTGCTGTGATGACTCG

GCCTTGGCACGAAGCCCAGCCCGCGGCCTGCTGGGTG - UNI27805 - GTCCCCGGCTATACAAGGAACCCAGCGCCAAGTCTAACAAGTTTATCAT

CCACAATGCCTTGTCACACTGCTGCCTGGCAGGCAAGGTGAATGAGCCCCAGAAGAACAGAATTCTAGAG GAAATCGAGAAAAGCAAGGCCAACCACTT

CCTGATTCTCTTTCGGGACTCAAGCTGCCAGTTCCGGGCCCTCTACACTCTGTCTGGGGAGACAGAGGAGCTATCGAGGCTGGCAGGCTATGGGCCTCGG

ACCGTCACTCCTGCCATGGTCGAAGGCATCTATAAGTACAACTCGGATCGCAAACGGTTCACCCAGATCCCTGCTAAAACCATGTCTATGAGTGTAGACG

CCTTCACTATCCAGGGACACCTTTGGCAAAGCAAGAAGCCCACCACGCCCAAGAAGGGTGGCGGTACCCCCAAATAGTGCCCACCTTGGGCAGTGCACTC

CTGGGTCCTGTCTGGTCATGCTGTGGGGGGCTGAGCTGGGAGCTTCAGTGACTCAGGGCTCAGCTCAGTCCCCTTGTCTGTCCTCCACTTTCTTGAATAA

AATAACTGAAAAGAGAAGCTG
Translation
MVEAAPAGSGPLRRTFLVPEIKSLDQYDFSRAKAAASLAWVLRAAFGGAE - UNI36319 - EHVPPELWEPFYTDQYAQEHVKPPVTRLLLSAELYC

RAWRQALPQLEPSPSPSALLALLARRGTVPSLPEHPVREADLKHQPILM GAHLAVIDALMVAFSFEWTKTLPGPLALSSLEHKLLFWVDT - UNI320

90 - TVRRLQEKTEQEAAQRASPAAPLDGASPAQPS - UNI14651 - IRYRKDRAIARRAPCFPNVTTLQDLASGAALAATIHCYCPQLLRLEE -

 UNI33057 - EVCLKDPMSVADSLYNLQLVQDFCASHLPRGCPLSLEDLLYVPPPLK VNLVVLLAEMYMCFEVLKPDFVQAKDLPDGHA AVSPRNT

ETVPSQNNSGSS - UNI30335 - SSPVFNFRHPLLSPGGPQSPLRGSTG GSLKSSPSMSHMEALGKAWNRQLS SRPLSQAVSFSTPFGLDSDVDV

VMGDPVLLRSVSSDSLGPPRPVSTSSRNSAQPAPESGDLPTIEEALQIIHSAEPRLLPDGAADGSFYLHSPEGLSKPPLSPYPPEGASKPLSDRLNKAPI

YISHPENPSKSSPCSTGEILKPPPPSEGSPKAVASSPAANNSEVKMTSFAERKKQLVKAEAESGLGSPTSTPVAPEALSSEMSELGARLEEKRRAIEAQK

RRIEAIFAKHRQRLGKSAFLQVQPREAAGEAEEEAELGSVPGGERPAGEGQGEPSLRHKSVTFSPDLGPVPPEGLGDYNRAVSKLSAALSSLQRDMQRLT

DQQQRLLAPPEAPGPAPPPAAWVIPGPATGPKAASPSPARRAPAARRSPGPGPSPTPRSPKHARPAELKLAPLTRVLTPPHDVDSLPHLRKFSPSQVPVQ

TRSSILLSEGTPPEEPTTKPALIEIPLASLGEPAADEEGDGSPPGAEDSLEEEASSEGEPRSGLGFFYK DEDKPEDEMAQKRASLLERQQRRVEEARRR

KQWQEAEKEQKREEAAR RLAQEAPGLAFTTPVVASAAPVATLAPTTRAMAPAEEEVGPRRGDFTRLEYERRAQLKLMDDLDKVLRPRASGTGGPGRGGR

RATRPRSGCCDDSALARSPARGLLGG - UNI27805 - GPRLYKEPSAKSNKFIIHNALSHCCLAGKVNEPQKNRILE EIEKSKANHFLILFRDSSC

QFRALYTLSGETEELSRLAGYGPRTVTPAMVEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQSKKPTTPKKGGGTPK
Transcript ENSMUST00000057028
Sequence
ATTAGTAACAGCAGCAGCCGCGGCGGCAACCCGATTCGGGGTGGCGGAGGCTCGGCAGCAGCGCAGCGCAGCGCAGCGCACGCAGCCCAGCCCATCAGAG

CGCGCGGACCCGGGCGGCCGTAACCCCGGCGTCGCCATGGTGGAAGCGGCGCCCGCAGGGTCCGGGCCACTGCGGAGGACTTTCCTGGTCCCCGAGATCA

AGTCTTTGGACCAGTACGATTTCTCTCGAGCCAAGGCGGCGGCGAGTCTGGCGTGGGTGCTGCGGGCCGCATTCGGGGGAGCAG - UNI36319 - AG

CATGTGCCTCCGGAGCTGTGGGAACCCTTCTACACCGATCAGTACGCACAGGAGCACGTGAAGCCCCCAGTGACGCGGCTGCTGCTCTCTGCGGAACTAT

ACTGTCGGGCCTGGCGCCAGGCACTGCCACAGCTCGAGCCATCCCCCAGTCCCTCTGCTCTGTTGGCCTTGCTGGCGAGGAGGGGCACGGTGCCTTCACT

GCCTGAGCACCCAGTGCGCGAGGCTGACCTGAAACACCAGCCAATTCTCATG GGAGCCCACCTAGCTGTCATCGATGCTCTCATGGTTGCCTTCTCATT

TGAGTGGACAAAGACACTACCTGGTCCCTTGGCTCTGAGCAGCTTGGAGCACAAACTCCTTTTCTGGGTAGACACA - UNI32090 - ACTGTTCGGC

GGCTGCAGGAGAAGACAGAACAAGAAGCAGCCCAGCGTGCATCTCCTGCAGCCCCTCTGGATGGGGCCTCTCCTGCCCAGCCCTCG - UNI14651 - 

ATTCGATATCGCAAGGACCGTGCCATTGCCCGAAGGGCTCCCTGCTTTCCAAATGTGACTACCCTTCAGGACCTGGCCAGTGGGGCAGCACTGGCTGCCA

CCATCCACTGCTATTGTCCCCAGCTATTACGACTTGAGG - UNI33057 - AGGTGTGCCTCAAGGACCCCATGTCTGTGGCAGACAGTCTATACAAC

CTCCAGCTGGTGCAAGACTTCTGTGCCTCCCATCTTCCTCGAGGCTGCCCCCTGTCCCTTGAAGACTTGCTGTATGTCCCACCACCCCTCAAG GTCAAC

CTGGTGGTGCTGTTGGCTGAGATGTATATGTGCTTTGAGGTTCTGAAGCCTGATTTTGTGCAGGCCAAAGACTTGCCTGATGGACATG CTGTCTCCCCC

CGGAATACAGAGACTGTTCCATCTCAGAACAACAGTGGCAGCAG - UNI30335 - TTCTCCTGTCTTCAACTTCCGTCACCCACTTCTGTCACCTGG

TGGTCCCCAGTCTCCACTCCGAGGATCCACAG GCTCCCTGAAGTCCTCTCCATCAATGTCTCACATGGAGGCTCTTGGCAAAGCCTGGAACCGTCAGCT

TAG CCGTCCCCTCTCCCAGGCTGTGTCGTTCAGCACTCCCTTTGGCCTGGACAGCGATGTGGATGTCGTCATGGGAGATCCTGTCCTGCTCCGCTCCGT

CAGCTCAGACAGTCTGGGTCCTCCACGTCCTGTGTCAACATCATCCCGGAATTCTGCTCAGCCAGCCCCAGAATCTGGAGACCTACCCACGATTGAAGAG

GCCCTGCAGATCATTCACAGTGCTGAGCCCCGACTGCTCCCTGATGGGGCTGCTGATGGCAGTTTCTACCTCCATTCTCCTGAGGGTCTCTCCAAACCAC

CACTCTCCCCCTACCCTCCCGAAGGAGCCTCAAAGCCGCTGTCTGATAGGCTCAACAAGGCGCCTATCTATATATCACACCCTGAGAACCCTTCAAAATC

ATCTCCCTGCTCAACAGGAGAGATACTGAAACCACCACCCCCATCCGAGGGTTCCCCCAAAGCTGTGGCTTCATCCCCAGCAGCCAACAACTCCGAAGTG

AAGATGACCAGTTTTGCTGAACGCAAGAAACAGCTGGTGAAGGCTGAGGCTGAGTCAGGATTGGGGTCTCCAACATCCACCCCCGTAGCACCTGAGGCCT

TGAGCTCAGAGATGAGTGAGCTGGGAGCCAGGCTGGAGGAGAAGCGCCGAGCCATAGAGGCACAGAAACGACGCATTGAGGCAATCTTTGCCAAGCATAG

GCAGAGGCTGGGCAAGAGCGCTTTCCTGCAGGTGCAGCCTCGGGAGGCTGCAGGGGAGGCCGAGGAGGAAGCTGAGCTGGGCTCAGTTCCTGGTGGGGAA

CGGCCAGCAGGTGAGGGCCAGGGTGAGCCGTCCTTACGGCACAAGTCAGTTACCTTCTCTCCAGACCTGGGCCCAGTGCCCCCAGAGGGACTTGGGGATT

ACAATAGAGCAGTCAGTAAGCTGAGTGCCGCTCTGAGCTCTCTGCAGCGGGACATGCAGAGGCTCACAGACCAGCAACAGCGGCTTCTAGCCCCTCCAGA

AGCTCCTGGACCTGCCCCACCACCTGCAGCCTGGGTCATTCCTGGACCCGCCACTGGGCCTAAAGCAGCATCCCCCAGCCCTGCCCGTCGTGCCCCAGCT

GCCCGACGCAGCCCTGGGCCAGGCCCCAGCCCAACACCCCGTAGTCCAAAACATGCAAGGCCGGCAGAGCTGAAGCTTGCACCTTTGACAAGGGTACTCA

CACCACCCCATGATGTAGACAGCCTCCCTCACCTACGCAAGTTTTCACCCAGCCAGGTGCCTGTACAGACTCGCTCCTCTATCCTCCTGTCGGAGGGGAC

ACCTCCCGAGGAGCCCACCACCAAGCCTGCCCTCATTGAGATCCCTCTAGCCAGCCTGGGGGAGCCTGCTGCTGATGAGGAAGGAGATGGGAGCCCCCCT

GGGGCTGAGGATTCCTTAGAGGAAGAGGCATCTTCTGAGGGAGAGCCCCGATCAGGGCTTGGATTCTTTTATAAG GACGAAGACAAGCCTGAGGATGAG

ATGGCTCAGAAGCGAGCTAGCCTGCTGGAGCGTCAGCAGAGGCGGGTAGAGGAAGCCCGGCGGCGCAAACAGTGGCAGGAGGCAGAGAAGGAGCAGAAAC

GGGAGGAGGCCGCCAG GCTGGCTCAGGAGGCTCCAGGCTTGGCCTTTACAACTCCTGTTGTAGCCTCTGCGGCTCCAGTGGCCACCTTGGCTCCTACTA

CCAGAGCCATGGCCCCAGCTGAGGAGGAGGTGGGCCCCCGGCGGGGGGACTTCACAAGACTTGAGTATGAACGCCGGGCACAACTGAAACTGATGGATGA

CCTTGATAAGGTGCTACGGCCCCGGGCCTCAGGGACCGGGGGACCAGGGCGGGGCGGGCGCAGGGCCACCCGGCCACGCTCTGGTTGCTGTGATGACTCG

GCCTTGGCACGAAGCCCAGCCCGCGGCCTGCTGG GTTCACGGCTCAGCAAGGTCTATTCCCAGTCCACGCTGTCCCTATCTACGGTGGCCAACGAGGCT

CCCAATAACCTTGGTGTGAAGAGGCCCACCTCTCG - UNI27805 - GGCCCCTTCTCCATCAGGCCTCATGTCTCCAAGCCGCCTGCCTGGCAGTCG

AGAACGTGACTGGGAGAATGGAAGCAATGCATCCTCCCCAGCATCAGTGCCTGAGTACACAG GTCCCCGGCTATACAAGGAACCCAGCGCCAAGTCTAA

CAAGTTTATCATCCACAATGCCTTGTCACACTGCTGCCTGGCAGGCAAGGTGAATGAGCCCCAGAAGAACAGAATTCTAGAG GAAATCGAGAAAAGCAA

GGCCAACCACTTCCTGATTCTCTTTCGGGACTCAAGCTGCCAGTTCCGGGCCCTCTACACTCTGTCTGGGGAGACAGAGGAGCTATCGAGGCTGGCAGGC

TATGGGCCTCGGACCGTCACTCCTGCCATGGTCGAAGGCATCTATAAGTACAACTCGGATCGCAAACGGTTCACCCAGATCCCTGCTAAAACCATGTCTA

TGAGTGTAGACGCCTTCACTATCCAGGGACACCTTTGGCAAAGCAAGAAGCCCACCACGCCCAAGAAGGGTGGCGGTACCCCCAAATAGTGCCCACCTTG

GGCAGTGCACTCCTGGGTCCTGTCTGGTCATGCTGTGGGGGGCTGAGCTGGGAGCTTCAGTGACTCAGGGCTCAGCTCAGTCCCCTTGTCTGTCCTCCAC

TTTCTTGAATAAAATAACTGAAAAGAGAAGCTG
Translation
MVEAAPAGSGPLRRTFLVPEIKSLDQYDFSRAKAAASLAWVLRAAFGGAE - UNI36319 - EHVPPELWEPFYTDQYAQEHVKPPVTRLLLSAELYC

RAWRQALPQLEPSPSPSALLALLARRGTVPSLPEHPVREADLKHQPILM GAHLAVIDALMVAFSFEWTKTLPGPLALSSLEHKLLFWVDT - UNI320

90 - TVRRLQEKTEQEAAQRASPAAPLDGASPAQPS - UNI14651 - IRYRKDRAIARRAPCFPNVTTLQDLASGAALAATIHCYCPQLLRLEE -

 UNI33057 - EVCLKDPMSVADSLYNLQLVQDFCASHLPRGCPLSLEDLLYVPPPLK VNLVVLLAEMYMCFEVLKPDFVQAKDLPDGHA AVSPRNT

ETVPSQNNSGSS - UNI30335 - SSPVFNFRHPLLSPGGPQSPLRGSTG GSLKSSPSMSHMEALGKAWNRQLS SRPLSQAVSFSTPFGLDSDVDV

VMGDPVLLRSVSSDSLGPPRPVSTSSRNSAQPAPESGDLPTIEEALQIIHSAEPRLLPDGAADGSFYLHSPEGLSKPPLSPYPPEGASKPLSDRLNKAPI

YISHPENPSKSSPCSTGEILKPPPPSEGSPKAVASSPAANNSEVKMTSFAERKKQLVKAEAESGLGSPTSTPVAPEALSSEMSELGARLEEKRRAIEAQK

RRIEAIFAKHRQRLGKSAFLQVQPREAAGEAEEEAELGSVPGGERPAGEGQGEPSLRHKSVTFSPDLGPVPPEGLGDYNRAVSKLSAALSSLQRDMQRLT

DQQQRLLAPPEAPGPAPPPAAWVIPGPATGPKAASPSPARRAPAARRSPGPGPSPTPRSPKHARPAELKLAPLTRVLTPPHDVDSLPHLRKFSPSQVPVQ

TRSSILLSEGTPPEEPTTKPALIEIPLASLGEPAADEEGDGSPPGAEDSLEEEASSEGEPRSGLGFFYK DEDKPEDEMAQKRASLLERQQRRVEEARRR

KQWQEAEKEQKREEAAR RLAQEAPGLAFTTPVVASAAPVATLAPTTRAMAPAEEEVGPRRGDFTRLEYERRAQLKLMDDLDKVLRPRASGTGGPGRGGR

RATRPRSGCCDDSALARSPARGLLG GSRLSKVYSQSTLSLSTVANEAPNNLGVKRPTSR - UNI27805 - RAPSPSGLMSPSRLPGSRERDWENGS

NASSPASVPEYTG GPRLYKEPSAKSNKFIIHNALSHCCLAGKVNEPQKNRILE EIEKSKANHFLILFRDSSCQFRALYTLSGETEELSRLAGYGPRTV

TPAMVEGIYKYNSDRKRFTQIPAKTMSMSVDAFTIQGHLWQSKKPTTPKKGGGTPK

For any suggestions or comments, please send an email to unitrap@crg.es