Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044465 (4632419K20Rik)
Chromosomal location
Chr 7: 112527125 - 112548546 (-)
Description
family with sequence similarity 160, member A2 Gene [Source:MGI Symbol;Acc:MGI:1921599]
RefSeq_peptide
NP_950174.1 
UniGene
Mm.445223 Mm.30254 
MGI
MGI:1921599 
Uniprot/SWISSPROT
Q3U2I3 
Uniprot/SPTREMBL
Q8VDK9 
Human Ortholog
ENSG00000051009 (FAM160A2)
Omim not available
UniTrap UNI25794
Vector Insertion
Chr 7: 112540182 - 112548397
Public Clones (sanger)
Private Clones OST166183 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8317
Vector Insertion
Chr 7: 112533937 - 112536697
Public Clones RRF380 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36552
Vector Insertion
Chr 7: 112527124 - 112529733
Public Clones IST10857C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048079
Sequence
GGCTGGTTCGCCTGAGGAGCGATGGCGGCGGCCTGAACTCACCTAGCCCGGCCGCCGACAGGCCCGGGCAGGGCGGCGTGGTGCAAGTGAAAGAGACGCG

TGGGCCGCGGCGCGCGCAGAGGCGCAAG - UNI25794 - ACTTGCAACACTGGACTGGACAGTGAACTCTGAGCTTGCTACTGCTCTAGTTTGGTGT

AATTTGTGGCTCTGTGGCCAGCTACTGGCTCCTACAGACCGGATGAAGCAGATTGGAGACAGAAGTGGAGAAAGCCTCCAGCTGGTACATTCTCAGAGTG

TAGTCCTCTGGCTGCTGGCCCTGTCCAGCCTGCCTCATGGAGAAGATGAACTGGTTAAGCAGGCTGGCCTCCCGGGTCCCTGGGCACCGTGTACCACAAG

GGGCCAGTCTACAGACCCCTGTCATGGCTGACCCTGAGACATGCCTCATGGTCTTCAAGAATCATTGGTCCCAG GTGGTACGAATCCTGGAGCGGCAAG

GCCCTCGGGCAGCTACTGGAGGTGCAGATGATCTCAGTGCTGTGAGAAACCACACGTACCAAATGCTAACATTGCTGGCAGAGGATCGAGCAGTTCCTTC

AGCTCCCTCAGGCCCTGGGCCCCTGCTAGAGTTTGCTCTTCGTGAAGATCTGCTGAGCCGAGTGTTGACATGGCAGTTGCAATGGGATGAGTTTGGGGAT

GGGGTTGAAGAACGGCGGGCTGAACAGTTGAAACTATTTGAAATGCTAGTGAGCGAAGCTCGCCAACCTCTGTTGCGGCATGGGCCAGTTCGAGAGGCTC

TGCTTGCCCTACTGGATGCCTGTGGCCGCCCTGTGCCCAGTAGTCCAGCACTGGATGAAGGCCTGGTGCTACTTCTCAGCCAACTGTGCGTGTGTGTTGC

TCGGGAGCCTTCACTGCTCGAGTTCTTCTTGCAGCCACCCCCAGAGCCTGGAGCTGCTCCACGTCTTCTCCTCTTTTCTCGCCTTGTCCCCTTTGTCCAT

CGAGAAGGCACCCTGGGCCAGCAGGCCCGTGATGCTCTACTTCTGCTCATGGCTCTGTCAGATGGGAGCCCCACTGTGGGCCGCTACATCGCAGATCACT

CTTACTTCTGCCCG GTGCTGGCCACAGGGCTGAGCGCCCTGTACTCCTCACTGCCTCGAAAGATTGAGGTTCCGGGGGATGATTGGCACTGCTTGCGCC

GGGAAGACTGGATAGGAGTGCCTGCCCTTGCACTCTTCATGAGTTCCCTTGAGTTCTGCAATGCAGTCATTCAG GTAGCTCACCCGCTGGTGCAGAAGC

AGCTGGTTGATTATATTCACAATGGTTTCCTGGTGCCTGTCATGGGCCCTGCCCTGCACAAG ACCTCTGTGGAGGAGATGATTGCGAGTACCGCCTACC

TGGAACTTTTCCTGCGGAGCATCTCAGAGCCTGCTTTGCTCCGTACCTTCCTGCGATTCCTGTTGTTACATCGGCATGATACCCACACCATCCTTGACAC

GCTCGTTGCCCGTATTGGCAGCAACTCCCGG - UNI8317 - CTCTGCATGGTCTCTCTGAGTCTCTTCAGGACCCTTCTGAACCTCAGCTGTGAGGA

TGTTCTGCTGCAGCTGGTTCTCAG GTATCTTGTCCCATGTAACCATGTGATGCTAAGCCAGAAGCCAGCTGTGCGTGATGTGGATCTTTATGGACGAGC

AGCTGACAAGTTTCTCTCCCTAATACCACGCTGCTGCCGGCACCATGCCCCTAGCCCACCTCGACCAGAGCATGCCTCATGGGCACGAG GCCCTGGAAG

CCCAAGTGTTGATTCTTCGTCAGTGGTAACAGTGCCCCGCCCCTCCACACCATCTCGTCTGGCTCTGTTTCTTCGGCAACAGAGCCTAGGTGGCTCTGAG

TCCCCAGGTCCAGTTCCTCGATCACCAGGGCTTACTGCATCTCCAACTTCCAGCCCTAGTCGAAGGCCCAGCCCTGCAGAGGAGCCTGGTGAGCTAGAAG

ACAATTACCTGGAGTATCTGCGTGAGGCACGCCGTGGTGTAGACCGCTGTGTCCGAGCCTGCCGAACCTGGTCTGCCCCTTATGATGGCGAGCGCCCCCC

TCCTGAGCCTAACCCTCTTGGCTCCCGGACTAAGAAACGCAGTCTACTACCAGAGGAAGACAGGGACAATGTAAGGGAAGGAGAGGAGGAAAACCTAGGG

AGTCGAGGGTTAGCTGTGGGTGTAGGGGATACCCCTGGCTACCTACTCCCACCCCAGCTCAATGGGGTACCAGGGCCATGGCCAGAAGGAGCCAAGAAGG

TTCGTCTGGTGCCACGATTGGTACCACAGGAAGGAGTTAGGGAATTGTTAGAGGGTACCTCTGAGGACATGGCAGGACTAGAGAGCTTTGGGCAAGAGCT

CCAGGAGCTGGAGGTGGCATTGAGCAATGGTGGAGCTGGCTCAGAGCCTCCCTTAGAGCCTCCACTACCTCCTGAGGAGGAGGAGGCCTACGAGAGCTTC

ACCTGCCCTCCTGAGCCCCCCGGCCCCTTCCTCAGCAGCCCTTTGCGGACTCTCCACCAGCTGCCGAGCCAGCCCTTCACTG GCCCCTTCATGGCTGTG

CTCTTTGCCAAACTCGAGAACATGCTGCAGAACTCCGTCTATGTCAACTTCCTGCTGACGGGGCTGGTGGCCCAGCTGGCCTGTCACCCCCAGCCCCTGC

TCCGCTCTTTCCTGCTCAACACCAACATGGTCTTCCAGCCCAGTGTCAAGTCCCTGCTGCAG GTGCTGGGCTCTGTGAAGAATAAGATTGAGAGCTTTG

CGGCCTCCCAGGAGGACTTCCCTGCTCTGCTATCCAAAGCCAAGAAGTACCTCATTGCCCGTGGCAAGCTGGACTGGGCTGAGGGTCCTACAGCAGGACC

TGCCCCCCGCCGCTCTGATTCCCTAG - UNI36552 - TGAGGAGCCGGAGGCCATCCTTGGGGGAATTACTCCTGCGGCATGCACACAGCCCAACCA

GGGCCCGACAGGCGGTGCAGGTTCTCCAACCTGGGCGAGATGGAACAGGACTTGGACTAGGTGGGGGCTCTCCAGGGGCTTCAACTCCAGTTCTACTTCC

CCGGGGCGGGGCTTCTGAGCGCCAAGGTGAGGCTCTTCGAGTCAAGAATGCTGTCTACTGTGCAGTCATTTTCCCTGAGTTTCTCAAGGAGTTGGCTGCC

ATCTCCCAGGCCCATGCTGTCACCTCGCCTTTCTTGTTGGATACTTCAGAGGAGGTATCTCTTCCTCCCATCTCAGGCTTTGGGCCCCTCAATCCTTAGT

TTTCTTCCATGGACAATCAGGGCCTTCTGTGGCCTGGGCTGAAATCCAGGACACGGGCTCCTTTTTATGTTTGGAGGCAGTGGCAAATGGACTTTTTAAT

TTATTCCAGATGAATGTTTTATGAGAACTTGTTGCAATATGTATAAAAGGGAAATCTCT
Translation
 - UNI25794 - MEKMNWLSRLASRVPGHRVPQGASLQTPVMADPETCLMVFKNHWSQ VVRILERQGPRAATGGADDLSAVRNHTYQMLTLLAEDRA

VPSAPSGPGPLLEFALREDLLSRVLTWQLQWDEFGDGVEERRAEQLKLFEMLVSEARQPLLRHGPVREALLALLDACGRPVPSSPALDEGLVLLLSQLCV

CVAREPSLLEFFLQPPPEPGAAPRLLLFSRLVPFVHREGTLGQQARDALLLLMALSDGSPTVGRYIADHSYFCP VLATGLSALYSSLPRKIEVPGDDWH

CLRREDWIGVPALALFMSSLEFCNAVIQ VAHPLVQKQLVDYIHNGFLVPVMGPALHK TSVEEMIASTAYLELFLRSISEPALLRTFLRFLLLHRHDTH

TILDTLVARIGSNSR - UNI8317 - LCMVSLSLFRTLLNLSCEDVLLQLVLR RYLVPCNHVMLSQKPAVRDVDLYGRAADKFLSLIPRCCRHHAPS

PPRPEHASWARG GPGSPSVDSSSVVTVPRPSTPSRLALFLRQQSLGGSESPGPVPRSPGLTASPTSSPSRRPSPAEEPGELEDNYLEYLREARRGVDRC

VRACRTWSAPYDGERPPPEPNPLGSRTKKRSLLPEEDRDNVREGEEENLGSRGLAVGVGDTPGYLLPPQLNGVPGPWPEGAKKVRLVPRLVPQEGVRELL

EGTSEDMAGLESFGQELQELEVALSNGGAGSEPPLEPPLPPEEEEAYESFTCPPEPPGPFLSSPLRTLHQLPSQPFTG GPFMAVLFAKLENMLQNSVYV

NFLLTGLVAQLACHPQPLLRSFLLNTNMVFQPSVKSLLQ VLGSVKNKIESFAASQEDFPALLSKAKKYLIARGKLDWAEGPTAGPAPRRSDSLV - UN

I36552 - VRSRRPSLGELLLRHAHSPTRARQAVQVLQPGRDGTGLGLGGGSPGASTPVLLPRGGASERQGEALRVKNAVYCAVIFPEFLKELAAISQA

HAVTSPFLLDTSEEVSLPPISGFGPLNP
Transcript ENSMUST00000074686
Sequence
GGCTGGTTCGCCTGAGGAGCGATGGCGGCGGCCTGAACTCACCTAGCCCGGCCGCCGACAGGCCCGGGCAGGGCGGCGTGGTGCAAGTGAAAGAGACGCG

TGGGCCGCGGCGCGCGCAGAGGCGCAAG - UNI25794 - ACTTGCAACACTGGACTGGACAGTGAACTCTGAGCTTGCTACTGCTCTAGTTTGGTGT

AATTTGTGGCTCTGTGGCCAGCTACTGGCTCCTACAGACCGGATGAAGCAGATTGGAGACAGAAGTGGAGAAAGCCTCCAGCTGGTACATTCTCAGAGTG

TAGTCCTCTGGCTGCTGGCCCTGTCCAGCCTGCCTCATGGAGAAGATGAACTGGTTAAGCAGGCTGGCCTCCCGGGTCCCTGGGCACCGTGTACCACAAG

GGGCCAGTCTACAGACCCCTGTCATGGCTGACCCTGAGACATGCCTCATGGTCTTCAAGAATCATTGGTCCCAG GTGGTACGAATCCTGGAGCGGCAAG

GCCCTCGGGCAGCTACTGGAGGTGCAGATGATCTCAGTGCTGTGAGAAACCACACGTACCAAATGCTAACATTGCTGGCAGAGGATCGAGCAGTTCCTTC

AGCTCCCTCAGGCCCTGGGCCCCTGCTAGAGTTTGCTCTTCGTGAAGATCTGCTGAGCCGAGTGTTGACATGGCAGTTGCAATGGGATGAGTTTGGGGAT

GGGGTTGAAGAACGGCGGGCTGAACAGTTGAAACTATTTGAAATGCTAGTGAGCGAAGCTCGCCAACCTCTGTTGCGGCATGGGCCAGTTCGAGAGGCTC

TGCTTGCCCTACTGGATGCCTGTGGCCGCCCTGTGCCCAGTAGTCCAGCACTGGATGAAGGCCTGGTGCTACTTCTCAGCCAACTGTGCGTGTGTGTTGC

TCGGGAGCCTTCACTGCTCGAGTTCTTCTTGCAGCCACCCCCAGAGCCTGGAGCTGCTCCACGTCTTCTCCTCTTTTCTCGCCTTGTCCCCTTTGTCCAT

CGAGAAGGCACCCTGGGCCAGCAGGCCCGTGATGCTCTACTTCTGCTCATGGCTCTGTCAGATGGGAGCCCCACTGTGGGCCGCTACATCGCAGATCACT

CTTACTTCTGCCCG GTGCTGGCCACAGGGCTGAGCGCCCTGTACTCCTCACTGCCTCGAAAGATTGAGGTTCCGGGGGATGATTGGCACTGCTTGCGCC

GGGAAGACTGGATAGGAGTGCCTGCCCTTGCACTCTTCATGAGTTCCCTTGAGTTCTGCAATGCAGTCATTCAG GTAGCTCACCCGCTGGTGCAGAAGC

AGCTGGTTGATTATATTCACAATGGTTTCCTGGTGCCTGTCATGGGCCCTGCCCTGCACAAG ACCTCTGTGGAGGAGATGATTGCGAGTACCGCCTACC

TGGAACTTTTCCTGCGGAGCATCTCAGAGCCTGCTTTGCTCCGTACCTTCCTGCGATTCCTGTTGTTACATCGGCATGATACCCACACCATCCTTGACAC

GCTCGTTGCCCGTATTGGCAGCAACTCCCGG - UNI8317 - CTCTGCATGGTCTCTCTGAGTCTCTTCAGGACCCTTCTGAACCTCAGCTGTGAGGA

TGTTCTGCTGCAGCTGGTTCTCAG GTATCTTGTCCCATGTAACCATGTGATGCTAAGCCAGAAGCCAGCTGTGCGTGATGTGGATCTTTATGGACGAGC

AGCTGACAAGTTTCTCTCCCTAATACCACGCTGCTGCCGGCACCATGCCCCTAGCCCACCTCGACCAGAGCATGCCTCATGGGCACGAG GCCCTGGAAG

CCCAAGTGTTGATTCTTCGTCAGTGGTAACAGTGCCCCGCCCCTCCACACCATCTCGTCTGGCTCTGTTTCTTCGGCAACAGAGCCTAGGTGGCTCTGAG

TCCCCAGGTCCAGTTCCTCGATCACCAGGGCTTACTGCATCTCCAACTTCCAGCCCTAGTCGAAGGCCCAGCCCTGCAGAGGAGCCTGGTGAGCTAGAAG

ACAATTACCTGGAGTATCTGCGTGAGGCACGCCGTGGTGTAGACCGCTGTGTCCGAGCCTGCCGAACCTGGTCTGCCCCTTATGATGGCGAGCGCCCCCC

TCCTGAGCCTAACCCTCTTGGCTCCCGGACTAAGAAACGCAGTCTACTACCAGAGGAAGACAGGGACAATGTAAGGGAAGGAGAGGAGGAAAACCTAGGG

AGTCGAGGGTTAGCTGTGGGTGTAGGGGATACCCCTGGCTACCTACTCCCACCCCAGCTCAATGGGGTACCAGGGCCATGGCCAGAAGGAGCCAAGAAGG

TTCGTCTGGTGCCACGATTGGTACCACAGGAAGGAGTTAGGGAATTGTTAGAGGGTACCTCTGAGGACATGGCAGGACTAGAGAGCTTTGGGCAAGAGCT

CCAGGAGCTGGAGGTGGCATTGAGCAATGGTGGAGCTGGCTCAGAGCCTCCCTTAGAGCCTCCACTACCTCCTGAGGAGGAGGAGGCCTACGAGAGCTTC

ACCTGCCCTCCTGAGCCCCCCGGCCCCTTCCTCAGCAGCCCTTTGCGGACTCTCCACCAGCTGCCGAGCCAGCCCTTCACTGGTAAG - UNI36552 -

 ATTGAGAGCTTTGCGGCCTCCCAGGAGGACTTCCCTGCTCTGCTATCCAAAGCCAAGAAGTACCTCATTGCCCGTGGCAAGCTGGACTGGGCTGAGGGT

CCTACAGCAGGACCTGCCCCCCGCCGCTCTGATTCCCTAG - UNI36552 - TGAGGAGCCGGAGGCCATCCTTGGGGGAATTACTCCTGCGGCATGC

ACACAGCCCAACCAGGGCCCGACAGGCGGTGCAGGTTCTCCAACCTGGGCGAGATGGAACAGGACTTGGACTAGGTGGGGGCTCTCCAGGGGCTTCAACT

CCAGTTCTACTTCCCCGGGGCGGGGCTTCTGAGCGCCAAGGTGAGGCTCTTCGAGTCAAGAATGCTGTCTACTGTGCAGTCATTTTCCCTGAGTTTCTCA

AGGAGTTGGCTGCCATCTCCCAGGCCCATGCTGTCACCTCGCCTTTCTTGTTGGATACTTCAGAGGAGGTATCTCTTCCTCCCATCTCAGGCTTTGGGCC

CCTCAATCCTTAGTTTTCTTCCATGGACAATCAGGGCCTTCTGTGGCCTGGGCTGAAATCCAGGACACGGGCTCCTTTTTATGTTTGGAGGCAGTGGCAA

ATGGACTTTTTAATTTATTCCAGATGAATGTTTTATGAGAACTTGTTGCAATATGTATAAAAGGGAAATCTCT
Translation
 - UNI25794 - MEKMNWLSRLASRVPGHRVPQGASLQTPVMADPETCLMVFKNHWSQ VVRILERQGPRAATGGADDLSAVRNHTYQMLTLLAEDRA

VPSAPSGPGPLLEFALREDLLSRVLTWQLQWDEFGDGVEERRAEQLKLFEMLVSEARQPLLRHGPVREALLALLDACGRPVPSSPALDEGLVLLLSQLCV

CVAREPSLLEFFLQPPPEPGAAPRLLLFSRLVPFVHREGTLGQQARDALLLLMALSDGSPTVGRYIADHSYFCP VLATGLSALYSSLPRKIEVPGDDWH

CLRREDWIGVPALALFMSSLEFCNAVIQ VAHPLVQKQLVDYIHNGFLVPVMGPALHK TSVEEMIASTAYLELFLRSISEPALLRTFLRFLLLHRHDTH

TILDTLVARIGSNSR - UNI8317 - LCMVSLSLFRTLLNLSCEDVLLQLVLR RYLVPCNHVMLSQKPAVRDVDLYGRAADKFLSLIPRCCRHHAPS

PPRPEHASWARG GPGSPSVDSSSVVTVPRPSTPSRLALFLRQQSLGGSESPGPVPRSPGLTASPTSSPSRRPSPAEEPGELEDNYLEYLREARRGVDRC

VRACRTWSAPYDGERPPPEPNPLGSRTKKRSLLPEEDRDNVREGEEENLGSRGLAVGVGDTPGYLLPPQLNGVPGPWPEGAKKVRLVPRLVPQEGVRELL

EGTSEDMAGLESFGQELQELEVALSNGGAGSEPPLEPPLPPEEEEAYESFTCPPEPPGPFLSSPLRTLHQLPSQPFTGK - UNI36552 - IESFAAS

QEDFPALLSKAKKYLIARGKLDWAEGPTAGPAPRRSDSLV - UNI36552 - VRSRRPSLGELLLRHAHSPTRARQAVQVLQPGRDGTGLGLGGGSPG

ASTPVLLPRGGASERQGEALRVKNAVYCAVIFPEFLKELAAISQAHAVTSPFLLDTSEEVSLPPISGFGPLNP
Transcript ENSMUST00000118726
Sequence
TGGTTCGCCTGAGGAGCGATGGCGGCGGCCTGAACTCACCTAGCCCGGCCGCCGACAGGCCCGGGCAGGGCGGCGTGGTGCAAGTGAAAGAGACGCGTGG

GCCGCGGCGCGCGCAGAGGCGCAAG - UNI25794 - ACTTGCAACACTGGACTGGACAGTGAACTCTGAGCTTGCTACTGCTCTAGTTTGGTGTAAT

TTGTGGCTCTGTGGCCAGCTACTGGCTCCTACAGACCGGATGAAGCAGATTGGAGACAGAAGTGGAGAAAGCCTCCAGCTGGTACATTCTCAGAGTGTAG

TCCTCTGGCTGCTGGCCCTGTCCAGCCTGCCTCATGGAGAAGATGAACTGGTTAAGCAGGCTGGCCTCCCGGGTCCCTGGGCACCGTGTACCACAAGGGG

CCAGTCTACAGACCCCTGTCATGGCTGACCCTGAGACATGCCTCATGGTCTTCAAGAATCATTGGTCCCAG GTGGTACGAATCCTGGAGCGGCAAGGCC

CTCGGGCAGCTACTGGAGGTGCAGATGATCTCAGTGCTGTGAGAAACCACACGTACCAAATGCTAACATTGCTGGCAGAGGATCGAGCAGTTCCTTCAGC

TCCCTCAGGCCCTGGGCCCCTGCTAGAGTTTGCTCTTCGTGAAGATCTGCTGAGCCGAGTGTTGACATGGCAGTTGCAATGGGATGAGTTTGGGGATGGG

GTTGAAGAACGGCGGGCTGAACAGTTGAAACTATTTGAAATGCTAGTGAGCGAAGCTCGCCAACCTCTGTTGCGGCATGGGCCAGTTCGAGAGGCTCTGC

TTGCCCTACTGGATGCCTGTGGCCGCCCTGTGCCCAGTAGTCCAGCACTGGATGAAGGCCTGGTGCTACTTCTCAGCCAACTGTGCGTGTGTGTTGCTCG

GGAGCCTTCACTGCTCGAGTTCTTCTTGCAGCCACCCCCAGAGCCTGGAGCTGCTCCACGTCTTCTCCTCTTTTCTCGCCTTGTCCCCTTTGTCCATCGA

GAAGGCACCCTGGGCCAGCAGGCCCGTGATGCTCTACTTCTGCTCATGGCTCTGTCAGATGGGAGCCCCACTGTGGGCCGCTACATCGCAGATCACTCTT

ACTTCTGCCCG GTGCTGGCCACAGGGCTGAGCGCCCTGTACTCCTCACTGCCTCGAAAGATTGAGGTTCCGGGGGATGATTGGCACTGCTTGCGCCGGG

AAGACTGGATAGGAGTGCCTGCCCTTGCACTCTTCATGAGTTCCCTTGAGTTCTGCAATGCAGTCATTCAG GTAGCTCACCCGCTGGTGCAGAAGCAGC

TGGTTGATTATATTCACAATGGTTTCCTGGTGCCTGTCATGGGCCCTGCCCTGCACAAG ACCTCTGTGGAGGAGATGATTGCGAGTACCGCCTACCTGG

AACTTTTCCTGCGGAGCATCTCAGAGCCTGCTTTGCTCCGTACCTTCCTGCGATTCCTGTTGTTACATCGGCATGATACCCACACCATCCTTGACACGCT

CGTTGCCCGTATTGGCAGCAACTCCCGG - UNI8317 - CTCTGCATGGTCTCTCTGAGTCTCTTCAGGACCCTTCTGAACCTCAGCTGTGAGGATGT

TCTGCTGCAGCTGGTTCTCAG GTATCTTGTCCCATGTAACCATGTGATGCTAAGCCAGAAGCCAGCTGTGCGTGATGTGGATCTTTATGGACGAGCAGC

TGACAAGTTTCTCTCCCTAATACCACGCTGCTGCCGGCACCATGCCCCTAGCCCACCTCGACCAGAGCATGCCTCATGGGCACGAGGTGGGCCTAGCAGA

GAGGCAGGGAGAAGGGAGGACATCACGG GCCCTGGAAGCCCAAGTGTTGATTCTTCGTCAGTGGTAACAGTGCCCCGCCCCTCCACACCATCTCGTCTG

GCTCTGTTTCTTCGGCAACAGAGCCTAGGTGGCTCTGAGTCCCCAGGTCCAGTTCCTCGATCACCAGGGCTTACTGCATCTCCAACTTCCAGCCCTAGTC

GAAGGCCCAGCCCTGCAGAGGAGCCTG GCCCCTTCATGGCTGTGCTCTTTGCCAAACTCGAGAACATGCTGCAGAACTCCGTCTATGTCAACTTCCTGC

TGACGGGGCTGGTGGCCCAGCTGGCCTGTCACCCCCAGCCCCTGCTCCGCTCTTTCCTGCTCAACACCAACATGGTCTTCCAGCCCAGTGTCAAGTCCCT

GCTGCAG GTGCTGGGCTCTGTGAAGAATAAGATTGAGAGCTTTGCGGCCTCCCAGGAGGACTTCCCTGCTCTGCTATCCAAAGCCAAGAAGTACCTCAT

TGCCCGTGGCAAGCTGGACTGGGCTGAGGGTCCTACAGCAGGACCTGCCCCCCGCCGCTCTGATTCCCTAG - UNI36552 - TGAGGAGCCGGAGGC

CATCCTTGGGGGAATTACTCCTGCGGCATGCACACAGCCCAACCAGGGCCCGACAGGCGGTGCAGGTTCTCCAACCTGGGCGAGATGGAACAGGACTTGG

ACTAGGTGGGGGCTCTCCAGGGGCTTCAACTCCAGTTCTACTTCCCCGGGGCGGGGCTTCTGAGCGCCAAGGTGAGGCTCTTCGAGTCAAGAATGCTGTC

TACTGTGCAGTCATTTTCCCTGAGTTTCTCAAGGAGTTGGCTGCCATCTCCCAGGCCCATGCTGTCACCTCGCCTTTCTTGTTGGATACTTCAGAGGAGG

TATCTCTTCCTCCCATCTCAGGCTTTGGGCCCCTCAATCCTTAGTTTTCTTCCATGGACAATCAGGGCCTTCTGTGGCCTGGGCTGAAATCCAGGACACG

GGCTCCTTTTTATGTTTGGAGGCAGTGGCAAATGGACTTTTTAATTTATTCCAGATGAATGTTTTATGAGAACTTGTTGCAATATGTATAAAAGGGAAAT

CTCT
Translation
 - UNI25794 - MEKMNWLSRLASRVPGHRVPQGASLQTPVMADPETCLMVFKNHWSQ VVRILERQGPRAATGGADDLSAVRNHTYQMLTLLAEDRA

VPSAPSGPGPLLEFALREDLLSRVLTWQLQWDEFGDGVEERRAEQLKLFEMLVSEARQPLLRHGPVREALLALLDACGRPVPSSPALDEGLVLLLSQLCV

CVAREPSLLEFFLQPPPEPGAAPRLLLFSRLVPFVHREGTLGQQARDALLLLMALSDGSPTVGRYIADHSYFCP VLATGLSALYSSLPRKIEVPGDDWH

CLRREDWIGVPALALFMSSLEFCNAVIQ VAHPLVQKQLVDYIHNGFLVPVMGPALHK TSVEEMIASTAYLELFLRSISEPALLRTFLRFLLLHRHDTH

TILDTLVARIGSNSR - UNI8317 - LCMVSLSLFRTLLNLSCEDVLLQLVLR RYLVPCNHVMLSQKPAVRDVDLYGRAADKFLSLIPRCCRHHAPS

PPRPEHASWARGGPSREAGRREDITG GPGSPSVDSSSVVTVPRPSTPSRLALFLRQQSLGGSESPGPVPRSPGLTASPTSSPSRRPSPAEEPG GPFMA

VLFAKLENMLQNSVYVNFLLTGLVAQLACHPQPLLRSFLLNTNMVFQPSVKSLLQ VLGSVKNKIESFAASQEDFPALLSKAKKYLIARGKLDWAEGPTA

GPAPRRSDSLV - UNI36552 - VRSRRPSLGELLLRHAHSPTRARQAVQVLQPGRDGTGLGLGGGSPGASTPVLLPRGGASERQGEALRVKNAVYCA

VIFPEFLKELAAISQAHAVTSPFLLDTSEEVSLPPISGFGPLNP
Transcript ENSMUST00000122327
Sequence
GTGTGGCGCGGGGCGGGGCGCGGCTGGTTCGCCTGAGGAGCGATGGCGGCGGCCTGAACTCACCTAGCCCGGCCGCCGACAGGCCCGGGCAGGGCGGCGT

GGTGCAAGTGAAAGAGACGCGTGGGCCGCGGCGCGCGCAGAGGCGCAAG - UNI25794 - CTCCTTTAGAATCTAAAGAGGAAACACAGCTGAGCCA

CATTCTGTGAAGAGTTTTTGCTCTTCAGTGACAATACTGATGAAGAGGTGTTAG ACTTGCAACACTGGACTGGACAGTGAACTCTGAGCTTGCTACTGC

TCTAGTTTGGTGTAATTTGTGGCTCTGTGGCCAGCTACTGGCTCCTACAGACCGGATGAAGCAGATTGGAGACAGAAGTGGAGAAAGCCTCCAGCTGGTA

CATTCTCAGAGTGTAGTCCTCTGGCTGCTGGCCCTGTCCAGCCTGCCTCATGGAGAAGATGAACTGGTTAAGCAGGCTGGCCTCCCGGGTCCCTGGGCAC

CGTGTACCACAAGGGGCCAGTCTACAGACCCCTGTCATGGCTGACCCTGAGACATGCCTCATGGTCTTCAAGAATCATTGGTCCCAG GTGGTACGAATC

CTGGAGCGGCAAGGCCCTCGGGCAGCTACTGGAGGTGCAGATGATCTCAGTGCTGTGAGAAACCACACGTACCAAATGCTAACATTGCTGGCAGAGGATC

GAGCAGTTCCTTCAGCTCCCTCAGGCCCTGGGCCCCTGCTAGAGTTTGCTCTTCGTGAAGATCTGCTGAGCCGAGTGTTGACATGGCAGTTGCAATGGGA

TGAGTTTGGGGATGGGGTTGAAGAACGGCGGGCTGAACAGTTGAAACTATTTGAAATGCTAGTGAGCGAAGCTCGCCAACCTCTGTTGCGGCATGGGCCA

GTTCGAGAGGCTCTGCTTGCCCTACTGGATGCCTGTGGCCGCCCTGTGCCCAGTAGTCCAGCACTGGATGAAGGCCTGGTGCTACTTCTCAGCCAACTGT

GCGTGTGTGTTGCTCGGGAGCCTTCACTGCTCGAGTTCTTCTTGCAGCCACCCCCAGAGCCTGGAGCTGCTCCACGTCTTCTCCTCTTTTCTCGCCTTGT

CCCCTTTGTCCATCGAGAAGGCACCCTGGGCCAGCAGGCCCGTGATGCTCTACTTCTGCTCATGGCTCTGTCAGATGGGAGCCCCACTGTGGGCCGCTAC

ATCGCAGATCACTCTTACTTCTGCCCG GTGCTGGCCACAGGGCTGAGCGCCCTGTACTCCTCACTGCCTCGAAAGATTGAGGTTCCGGGGGATGATTGG

CACTGCTTGCGCCGGGAAGACTGGATAGGAGTGCCTGCCCTTGCACTCTTCATGAGTTCCCTTGAGTTCTGCAATGCAGTCATTCAG GTAGCTCACCCG

CTGGTGCAGAAGCAGCTGGTTGATTATATTCACAATGGTTTCCTGGTGCCTGTCATGGGCCCTGCCCTGCACAAG ACCTCTGTGGAGGAGATGATTGCG

AGTACCGCCTACCTGGAACTTTTCCTGCGGAGCATCTCAGAGCCTGCTTTGCTCCGTACCTTCCTGCGATTCCTGTTGTTACATCGGCATGATACCCACA

CCATCCTTGACACGCTCGTTGCCCGTATTGGCAGCAACTCCCGG - UNI8317 - CTCTGCATGGTCTCTCTGAGTCTCTTCAGGACCCTTCTGAACC

TCAGCTGTGAGGATGTTCTGCTGCAGCTGGTTCTCAG GTATCTTGTCCCATGTAACCATGTGATGCTAAGCCAGAAGCCAGCTGTGCGTGATGTGGATC

TTTATGGACGAGCAGCTGACAAGTTTCTCTCCCTAATACCACGCTGCTGCCGGCACCATGCCCCTAGCCCACCTCGACCAGAGCATGCCTCATGGGCACG

AG GCCCTGGAAGCCCAAGTGTTGATTCTTCGTCAGTGGTAACAGTGCCCCGCCCCTCCACACCATCTCGTCTGGCTCTGTTTCTTCGGCAACAGAGCCT

AGGTGGCTCTGAGTCCCCAGGTCCAGTTCCTCGATCACCAGGGCTTACTGCATCTCCAACTTCCAGCCCTAGTCGAAGGCCCAGCCCTGCAGAGGAGCCT

GGTGAGCTAGAAGACAATTACCTGGAGTATCTGCGTGAGGCACGCCGTGGTGTAGACCGCTGTGTCCGAGCCTGCCGAACCTGGTCTGCCCCTTATGATG

GCGAGCGCCCCCCTCCTGAGCCTAACCCTCTTGGCTCCCGGACTAAGAAACGCAGTCTACTACCAGAGGAAGACAGGGACAATGTAAGGGAAGGAGAGGA

GGAAAACCTAGGGAGTCGAGGGTTAGCTGTGGGTGTAGGGGATACCCCTGGCTACCTACTCCCACCCCAGCTCAATGGGGTACCAGGGCCATGGCCAGAA

GGAGCCAAGAAGGTTCGTCTGGTGCCACGATTGGTACCACAGGAAGGAGTTAGGGAATTGTTAGAGGGTACCTCTGAGGACATGGCAGGACTAGAGAGCT

TTGGGCAAGAGCTCCAGGAGCTGGAGGTGGCATTGAGCAATGGTGGAGCTGGCTCAGAGCCTCCCTTAGAGCCTCCACTACCTCCTGAGGAGGAGGAGGC

CTACGAGAGCTTCACCTGCCCTCCTGAGCCCCCCGGCCCCTTCCTCAGCAGCCCTTTGCGGACTCTCCACCAGCTGCCGAGCCAGCCCTTCACTG GCCC

CTTCATGGCTGTGCTCTTTGCCAAACTCGAGAACATGCTGCAGAACTCCGTCTATGTCAACTTCCTGCTGACGGGGCTGGTGGCCCAGCTGGCCTGTCAC

CCCCAGCCCCTGCTCCGCTCTTTCCTGCTCAACACCAACATGGTCTTCCAGCCCAGTGTCAAGTCCCTGCTGCAG GTGCTGGGCTCTGTGAAGAATAAG

ATTGAGAGCTTTGCGGCCTCCCAGGAGGACTTCCCTGCTCTGCTATCCAAAGCCAAGAAGTACCTCATTGCCCGTGGCAAGCTGGACTGGGCTGAGGGTC

CTACAGCAGGACCTGCCCCCCGCCGCTCTGATTCCCTAG - UNI36552 - TGAGGAGCCGGAGGCCATCCTTGGGGGAATTACTCCTGCGGCATGCA

CACAGCCCAACCAGGGCCCGACAGGCGGTGCAGGTTCTCCAACCTGGGCGAGATGGAACAGGACTTGGACTAGGTGGGGGCTCTCCAGGGGCTTCAACTC

CAGTTCTACTTCCCCGGGGCGGGGCTTCTGAGCGCCAAGGTGAGGCTCTTCGAGTCAAGAATGCTGTCTACTGTGCAGTCATTTTCCCTGAGTTTCTCAA

GGAGTTGGCTGCCATCTCCCAGGCCCATGCTGTCACCTCGCCTTTCTTGTTGGATACTTCAGAGGAGGTATCTCTTCCTCCCATCTCAGGCTTTGGGCCC

CTCAATCCTTAGTTTTCTTCCATGGACAATCAGGGCCTTCTGTGGCCTGGGCTGAAATCCAGGACACGGGCTCCTTTTTATGTTTGGAGGCAGTGGCAAA

TGGACTTTTTAATTTATTCCAGATGAATGTTTTATGAGAACTTGTTGCAATATGTATAAAAGGGAAATCTC
Translation
 - UNI25794 -  MEKMNWLSRLASRVPGHRVPQGASLQTPVMADPETCLMVFKNHWSQ VVRILERQGPRAATGGADDLSAVRNHTYQMLTLLAEDR

AVPSAPSGPGPLLEFALREDLLSRVLTWQLQWDEFGDGVEERRAEQLKLFEMLVSEARQPLLRHGPVREALLALLDACGRPVPSSPALDEGLVLLLSQLC

VCVAREPSLLEFFLQPPPEPGAAPRLLLFSRLVPFVHREGTLGQQARDALLLLMALSDGSPTVGRYIADHSYFCP VLATGLSALYSSLPRKIEVPGDDW

HCLRREDWIGVPALALFMSSLEFCNAVIQ VAHPLVQKQLVDYIHNGFLVPVMGPALHK TSVEEMIASTAYLELFLRSISEPALLRTFLRFLLLHRHDT

HTILDTLVARIGSNSR - UNI8317 - LCMVSLSLFRTLLNLSCEDVLLQLVLR RYLVPCNHVMLSQKPAVRDVDLYGRAADKFLSLIPRCCRHHAP

SPPRPEHASWARG GPGSPSVDSSSVVTVPRPSTPSRLALFLRQQSLGGSESPGPVPRSPGLTASPTSSPSRRPSPAEEPGELEDNYLEYLREARRGVDR

CVRACRTWSAPYDGERPPPEPNPLGSRTKKRSLLPEEDRDNVREGEEENLGSRGLAVGVGDTPGYLLPPQLNGVPGPWPEGAKKVRLVPRLVPQEGVREL

LEGTSEDMAGLESFGQELQELEVALSNGGAGSEPPLEPPLPPEEEEAYESFTCPPEPPGPFLSSPLRTLHQLPSQPFTG GPFMAVLFAKLENMLQNSVY

VNFLLTGLVAQLACHPQPLLRSFLLNTNMVFQPSVKSLLQ VLGSVKNKIESFAASQEDFPALLSKAKKYLIARGKLDWAEGPTAGPAPRRSDSLV - U

NI36552 - VRSRRPSLGELLLRHAHSPTRARQAVQVLQPGRDGTGLGLGGGSPGASTPVLLPRGGASERQGEALRVKNAVYCAVIFPEFLKELAAISQ

AHAVTSPFLLDTSEEVSLPPISGFGPLNP

For any suggestions or comments, please send an email to unitrap@crg.es