Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044627 (2900010J23Rik)
Chromosomal location
Chr 2: 32134336 - 32143582 (-)
Description
RIKEN cDNA 2900010J23 gene Gene [Source:MGI Symbol;Acc:MGI:1920181]
RefSeq_peptide
NP_780399.1 
MGI
MGI:1920181 
Uniprot/SWISSPROT
Q8K3D3 
Uniprot/SPTREMBL
A2AN40 A2AN41 
Human Ortholog
ENSG00000175854 (C9orf119)
Omim not available
UniTrap UNI1998
Vector Insertion
Chr 2: 32143116 - 32143166
Public Clones BB0129 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37489
Vector Insertion
Chr 2: 32138208 - 32143166
Public Clones (sanger) PST18778-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19370
Vector Insertion
Chr 2: 32137331 - 32138208
Public Clones not available
Private Clones OST393256 (lexicon) OST301777 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18011
Vector Insertion
Chr 2: 32134336 - 32134652
Public Clones not available
Private Clones OST432161 (lexicon) OST349136 (lexicon) OST250120 (lexicon) OST235433 (lexicon)
OST165415 (lexicon) OST79370 (lexicon) OST33235 (lexicon)
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113395
Sequence
GGTCTGGCTCACCCATACCCATGCCTGCAGGGTCAGCTCTGTTGTACTGCCCAGGGCCTGCTTTTCTGTTGTGCTTATGAAGGATAGGACCAGCTCTCAA

GCTCCAACAAATTTTAGGAGTTGATTCTCTCTACCAGGGTTCTAAGGATCAAACTCAAGGTTGTCAGGATTACAAG - UNI19370 - CAACGGCCAT

TCCCCATGATTGATGAGAATAACGATGTCAGCGAGGAGGCCTTGAGCTCTGACATTAAGAAACTGAAGGAGAAGCATGACATGCTGGACAAGGAGATCTC

CCAGTTAATAGCAGA GGGCTACCGTGTGATTGAGCTGGAGAAGCATATCTCCCTCCTCCATGAGTACAATGACATCAAGGATGTATCACAGATGCTGCT

GGGGAAGCTGG - UNI18011 - CTGTGACTCGAGGCGTTACCACCAAGGAGTTATATCCAGATTTTGATCTAAACCTGAATGACTGAGCAGCTTCTT

GGAGATTTTCATCTACAGCCCACAGGGACAGGAGGATGGGGGCATAAAAGGCAGAGTCTAGACAGTATGTTCATATGGTTTTCAGATTTTAAAAGATGCT

AGAAGCCCTCCAAAGTTTGGGGTGGGTTCTAGAGAAGAGGAGTATTGGGAGGGGTGGGTATTGTCAATGTTAAGGTTCCTAAACATACTTGTGAGTAGGT

GTGTGTGGTTGTCCCTTTTGTTAATAAACATATGAGCAGTC
Translation
 - UNI19370 - MIDENNDVSEEALSSDIKKLKEKHDMLDKEISQLIAE EGYRVIELEKHISLLHEYNDIKDVSQMLLGKLA - UNI18011 - A

VTRGVTTKELYPDFDLNLND
Transcript ENSMUST00000050410
Sequence
CGTGGGGCGGTTGGTGGTCTCCGTCGTCGGTTTCTAGTTCCCTGAAGCAGCCGTTTAACCCCAACCCTGGACCCTTCCGAGTTTAAGCCCACCCCACTCC

GGGTGCCCCGGACCTTAGGGTTCAGGAG - UNI1998 - GGGTGAGTCAGAATTCAGCCGACTTTACCATGGCGGCTACCGATCACCG - UNI1998

 - - UNI19370 - CAACGGCCATTCCCCATGATTGATGAGAATAACGATGTCAGCGAGGAGGCCTTGAGCTCTGACATTAAGAAACTGAAGGAGAAG

CATGACATGCTGGACAAGGAGATCTCCCAGTTAATAGCAGA GGGCTACCGTGTGATTGAGCTGGAGAAGCATATCTCCCTCCTCCATGAGTACAATGAC

ATCAAGGATGTATCACAGATGCTGCTGGGGAAGCTGG - UNI18011 - CTGTGACTCGAGGCGTTACCACCAAGGAGTTATATCCAGATTTTGATCT

AAACCTGAATGACTGAGCAGCTTCTTGGAGATTTTCATCTACAGCCCACAGGGACAGGAGGATGGGGGCATAAAAGGCAGAGTCTAGACAGTATGTTCAT

ATGGTTTTCAGATTTTAAAAGATGCTAGAAGCCCTCCAAAGTTTGGGGTGGGTTCTAGAGAAGAGGAGTATTGGGAGGGGTGGGTATTGTCAATGTTAAG

GTTCCTAAACATACTTGTGAGTAGGTGTGTGTGGTTGTCCCTTTTGTTAATAAACATATGAGCAGT
Translation
 - UNI1998 -  - UNI1998 - - UNI19370 - MIDENNDVSEEALSSDIKKLKEKHDMLDKEISQLIAE EGYRVIELEKHISLLHEYNDIKD

VSQMLLGKLA - UNI18011 - AVTRGVTTKELYPDFDLNLND
Transcript ENSMUST00000113397
Sequence
AACTTGGTGCGTGCGCAGCCTGACGTGGGGCGGTTGGTGGTCTCCGTCGTCGGTTTCTAGTTCCCTGAAGCAGCCGTTTAACCCCAACCCTGGACCCTTC

CGAGTTTAAGCCCACCCCACTCCGGGTGCCCCGGACCTTAGGGTTCAGGAG - UNI1998 - GGGTGAGTCAGAATTCAGCCGACTTTACCATGGCGG

CTACCGATCACCG - UNI1998 - - UNI19370 - GGGCTACCGTGTGATTGAGCTGGAGAAGCATATCTCCCTCCTCCATGAGTACAATGACATC

AAGGATGTATCACAGATGCTGCTGGGGAAGCTGG - UNI18011 - CTGTGACTCGAGGCGTTACCACCAAGGAGTTATATCCAGATTTTGATCTAAA

CCTGAATGACTGAGCAGCTTCTTGGAGATTTTCATCTACAGCCCACAGGGACAGGAGGATGGGGGCATAAAAGGCAGAGTCTAGACAGTATGTTCATATG

GTTTTCAGATTTTAAAAGATGCTAGAAGCCCTCCAAAGTTTGGGGTGGGTTCTAGAGAAGAGGAGTATTGGGAGGGGTGGGTATTGTCAATGTTAAGGTT

CCTAAACATACTTGTGAGTAGGTGTGTGTGGTTGTCCCTTTTGTTAATAAACATATGAGCAGTC
Translation
 - UNI1998 - MAATDHR - UNI1998 - - UNI19370 - RGYRVIELEKHISLLHEYNDIKDVSQMLLGKLA - UNI18011 - AVTRGVT

TKELYPDFDLNLND
Transcript ENSMUST00000113400
Sequence
ATGGGAAGCAGGGGCGGAACCGCTTTAACTTG - UNI1998 - GGGTGAGTCAGAATTCAGCCGACTTTACCATGGCGGCTACCGATCACCG - UNI

1998 - - UNI19370 - CAACGGCCATTCCCCATGATTGATGAGAATAACGATGTCAGCGAGGAGGCCTTGAGCTCTGACATTAAGAAACTGAAGGA

GAAGCATGACATGCTGGACAAGGAGATCTCCCAGTTAATAGCAGA GGGCTACCGTGTGATTGAGCTGGAGAAGCATATCTCCCTCCTCCATGAGTACAA

TGACATCAAGGATGTATCACAGATGCTGCTGGGGAAGCTGG - UNI18011 - CTGTGACTCGAGGCGTTACCACCAAGGAGTTATATCCAGATTTTG

ATCTAAACCTGAATGACTGAGCAGCTTCTTGGAGATTTTCATCTACAGCCCACAGGGACAGGAGGATGGGGGCATAAAAGGCAGAGTCTAGACAGTATGT

TCATATGGTTTTCAGATTTTAAAAGATGCTAGAAGCCCTCCAAAGTTTGGGGTGGGTTCTAGAGAAGAGGAGTATTGGGAGGGGTGGGTATTGTCAATGT

TAAGGTTCCTAAACATACTTGTGAGTAGGTGTGTGTGGTTGTCCCTTTTGTTAATAAACATATGAGCAGTC
Translation
MGSRGGTALTW - UNI1998 - WGESEFSRLYHGGYRSP - UNI1998 - - UNI19370 - QRPFPMIDENNDVSEEALSSDIKKLKEKHDMLD

KEISQLIAE EGYRVIELEKHISLLHEYNDIKDVSQMLLGKLA - UNI18011 - AVTRGVTTKELYPDFDLNLND

For any suggestions or comments, please send an email to unitrap@crg.es