Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044647 (Csnrp3)
Chromosomal location
Chr 2: 65683852 - 65863663 (+)
Description
cysteine-serine-rich nuclear protein 3 Gene [Source:MGI Symbol;Acc:MGI:1925021]
RefSeq_dna
NM_153409 
RefSeq_peptide
NP_700458.2 NP_848749.1 
UniGene
Mm.102025 Mm.398095 
MGI
MGI:1925021 
Uniprot/SWISSPROT
P59055 
Uniprot/SPTREMBL
Q7TNU4 
Human Ortholog
ENSG00000178662 (FAM130A2)
Omim not available
UniTrap UNI37565
Vector Insertion
Chr 2: 65683851 - 65683942
Public Clones (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26130
Vector Insertion
Chr 2: 65698750 - 65716021
Public Clones not available
Private Clones OST135441 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14549
Vector Insertion
Chr 2: 65716110 - 65787015
Public Clones FHCRC-GT-S6-6C1 (fhcrc) (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25810
Vector Insertion
Chr 2: 65787005 - 65787187
Public Clones not available
Private Clones OST164894 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112397
Sequence
TTGGTTGGCTGCGGCCTGATGGATGAAGGGCGGAGTGAGCTCTTCTCAGTGTGTTCTGCTGGAGCCCAAGTACAGAGACCATATTTACAG GTCCATGTG

ACAGCTATGAGTGGAATTTTAAAGGGGACGTTGGAAGAAGCTGGCAGCGCTTCACCCTGCTCTTCTGTGCAGGAATCAGATGATGACGTTTTTAGCTGTC

ACAGTGCTGAGAGTCTTGATAGTGTCAGTGTGTCCACACCTGATCCTTTACCC - UNI26130 - GAAAAAATAAGAGGATATCAAGAGGCTGAAAGA

ATATTTTCAGAAGCATAGACTCTTCGGAGGATACTGCAGTTCATGAGATCTCAAG - UNI14549 - - UNI25810 - GTACATGTGACAACGCCG

CAGCTATGAGTGGAATTTTAAAGAGGAAGTTCGAAGATGTGGACGCCTCCTCACCATGCTCCTCTGCTCGGGAATCGGATGATGAAGTCTCCAGCAGCGA

AAGTGCTGACAGCGGGGATAGCGTCAATCCATCCACCTCAAATCACTTCACCC - UNI25810 - CTTCCTCCATCCTGAAAAGGGAGAAACGGCTGA

GGACGAAGAATGTACACTTCAGCTGTGTCACCGTGTACTACTTCACCAGGAGGCAGGGCTTCACTAGTGTGCCCAGCCAGGGTGGCAGCACTCTGGGGAT

GTCCAGTCGTCACAACAGCGTGCGCCAGTACACCCTGGGCGAGTTTGCGCGAGAGCAGGAGCGCCTGCACCGGGAGATGCTGAGAGAACACCTCCGGGAG

GAGAAACTCAACTCTCTCAAACTAAAG ATGACTAAGAATGGCACTGTAGAGTCTGAGGAAGCTAGCACCCTGACCGTGGATGACATTTCCGATGACGAT

ATTGATCTGGACAACACCGAAGTGGACGAATACTTCTTCCTACAACCCCTGCCCACAAAAAAGCGGAGAGCTCTGCTGCGCGCCTCGGGGGTGAAGAAGA

TCGACGTTGACGAGAAGCACGAACTGCGGGCCATCCGCCTTTCTCGGGAGGACTGTGGCTGTGACTGCAGAGTGTTCTGTGATCCAGAAACCTGTACCTG

CAGCCTGGCAGGCATTAAGTGTCAG GTGGATCGTATGTCTTTCCCATGTGGCTGCACTAAAGAAGGCTGTAGTAACACAGCAGGTAGAATTGAATTCAA

TCCTATCCGTGTCCGGACTCATTTTTTGCACACAATAATGAAACTTGAACTGGAGAAGAACCGAGAGCAACAAACCCCCACGCTGAATGGCTGCCACGGG

GAGATAAGCGCCCATGGTCCTTCCATGGGCCCTGTCGCTCACTCTGTAGAATATTCCATCGCAGACAATTTCGAGATTGAAACCGAACCCCAGGCTGCTG

TGCTGCACCTACAGGAGGAACTGGACTGCCAAGGAGATGAGGAGGAAGAGGAGGAGGACGGAAGCAGTTTCTGCAGTGGAGCCACTGATTCTAGCACCCA

AAGCCTGGCTCCCAGTGAATCGGATGAGGAAGAGGAGGAGGAGGAAGAAGAAGAGGAAGAGGAGGAGGAAGATGACGACGACGACAAGGGAGATGGCTTT

GTAGAAGGGCTCGGAGCCCATACGGAGGTCGTCCCCCTTCCGTCTGTCCTTTGTTACTCTGATGGCACCGCAGTTCATGAAAGCCACACAAAAAATGCTT

CATTTTACGCTAGCTCTTCAACTCTCTACTACCAAATAGATAGTCACATCCCAGGAACTCCTAGCCAGCTCTCTGACAACTATTCTGAAAGAGATACTGT

CAAAAACGGTGCCCTTTCGCTGGTGCCTTACGCCATGACCCCAGAGAGGTTTGTTGACTACGCCAGGCAAGCAGAAGAGGCCTATGGAGCCTCCCACTAC

CCAGCTGCCAATCCGTCTGTCATCGTTTGCTGCCCCACCTCTGAAAACGATAGTGGGGTGCCCTGTAACCCCTTGTATCCTGAACACAGGTCCAATCTTC

CCCAAGTGGAGTTTCACTCATACTTGAAAGGCCCTGCCCAGGAAGGGTTTGTTTCCACATTGAATGGCGACAGCCACATTTCAGAGCATCCTGCAGAAAA

TCCTTTGAGCCTTGCAGAAAAGAGCAGATTGCATGAAGAGTGCATTCAGTCCCCCGTGGTGGAAACGGTCCCCGTTTAGTTGCTTAAATTATTCTATTAC

AGGACCAAGTCTTCTATTTAAGGCACTGTATTGCCTTTGCTGGGCTCATCGTTGTTTAAACCTGAAGGCCAAGAGTTATGTGGACTGTGATTAATCTTCC

AGACAGTATTTCCTTCCTTCCTTTCTAGCTTCCCAACTGTGGCGTGGCACAAATACAGTCGCTATGGGGATTTTAAACGATTTTGAACTGTTTTGATAGA

AAAATGCTAAATTTAAAAAAAATGCATATCTTACAGTTGCCTACCTGTCAAACTGTGTGAAACCTGCCAAGCTATGCAGATCATAGCTCCAAGTTTTAGA

TTATCGGGCCTGTGCAAGATTGTTAACTAAGACTAGAAAACAAGCAGATTTAGAGTCCTAATTTTTCGATATATCTGAAGATGATGGTGACTTTTTAATG

TAAAAGTAATTATTGTAAGAAAAAAAAAGATTGAATCGTT
Translation
  - UNI26130 - MRSQG - UNI14549 - - UNI25810 - GTCDNAAAMSGILKRKFEDVDASSPCSSARESDDEVSSSESADSGDSVNPSTS

NHFTP - UNI25810 - PSSILKREKRLRTKNVHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKL

NSLKLK MTKNGTVESEEASTLTVDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVDEKHELRAIRLSREDCGCDCRVFCDPETCTCSL

AGIKCQ VDRMSFPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQTPTLNGCHGEISAHGPSMGPVAHSVEYSIADNFEIETEPQAAVL

HLQEELDCQGDEEEEEEDGSSFCSGATDSSTQSLAPSESDEEEEEEEEEEEEEEEDDDDDKGDGFVEGLGAHTEVVPLPSVLCYSDGTAVHESHTKNASF

YASSSTLYYQIDSHIPGTPSQLSDNYSERDTVKNGALSLVPYAMTPERFVDYARQAEEAYGASHYPAANPSVIVCCPTSENDSGVPCNPLYPEHRSNLPQ

VEFHSYLKGPAQEGFVSTLNGDSHISEHPAENPLSLAEKSRLHEECIQSPVVETVPV
Transcript ENSMUST00000053910
Sequence
AGTGTGTTCTGCTGGAGCCCAAGTACAGAGACCATATTTACAG - UNI26130 - GAAAAAATAAGAGGATATCAAGAGGCTGAAAGAATATTTTCAG

AAGCATAGACTCTTCGGAGGATACTGCAGTTCATGAGATCTCAAG - UNI14549 - - UNI25810 - GTACATGTGACAACGCCGCAGCTATGAG

TGGAATTTTAAAGAGGAAGTTCGAAGATGTGGACGCCTCCTCACCATGCTCCTCTGCTCGGGAATCGGATGATGAAGTCTCCAGCAGCGAAAGTGCTGAC

AGCGGGGATAGCGTCAATCCATCCACCTCAAATCACTTCACCC - UNI25810 - CTTCCTCCATCCTGAAAAGGGAGAAACGGCTGAGGACGAAGAA

TGTACACTTCAGCTGTGTCACCGTGTACTACTTCACCAGGAGGCAGGGCTTCACTAGTGTGCCCAGCCAGGGTGGCAGCACTCTGGGGATGTCCAGTCGT

CACAACAGCGTGCGCCAGTACACCCTGGGCGAGTTTGCGCGAGAGCAGGAGCGCCTGCACCGGGAGATGCTGAGAGAACACCTCCGGGAGGAGAAACTCA

ACTCTCTCAAACTAAAG ATGACTAAGAATGGCACTGTAGAGTCTGAGGAAGCTAGCACCCTGACCGTGGATGACATTTCCGATGACGATATTGATCTGG

ACAACACCGAAGTGGACGAATACTTCTTCCTACAACCCCTGCCCACAAAAAAGCGGAGAGCTCTGCTGCGCGCCTCGGGGGTGAAGAAGATCGACGTTGA

CGAGAAGCACGAACTGCGGGCCATCCGCCTTTCTCGGGAGGACTGTGGCTGTGACTGCAGAGTGTTCTGTGATCCAGAAACCTGTACCTGCAGCCTGGCA

GGCATTAAGTGTCAG GTGGATCGTATGTCTTTCCCATGTGGCTGCACTAAAGAAGGCTGTAGTAACACAGCAGGTAGAATTGAATTCAATCCTATCCGT

GTCCGGACTCATTTTTTGCACACAATAATGAAACTTGAACTGGAGAAGAACCGAGAGCAACAAACCCCCACGCTGAATGGCTGCCACGGGGAGATAAGCG

CCCATGGTCCTTCCATGGGCCCTGTCGCTCACTCTGTAGAATATTCCATCGCAGACAATTTCGAGATTGAAACCGAACCCCAGGCTGCTGTGCTGCACCT

ACAGGAGGAACTGGACTGCCAAGGAGATGAGGAGGAAGAGGAGGAGGACGGAAGCAGTTTCTGCAGTGGAGCCACTGATTCTAGCACCCAAAGCCTGGCT

CCCAGTGAATCGGATGAGGAAGAGGAGGAGGAGGAAGAAGAAGAGGAAGAGGAGGAGGAAGATGACGACGACGACAAGGGAGATGGCTTTGTAGAAGGGC

TCGGAGCCCATACGGAGGTCGTCCCCCTTCCGTCTGTCCTTTGTTACTCTGATGGCACCGCAGTTCATGAAAGCCACACAAAAAATGCTTCATTTTACGC

TAGCTCTTCAACTCTCTACTACCAAATAGATAGTCACATCCCAGGAACTCCTAGCCAGCTCTCTGACAACTATTCTGAAAGAGATACTGTCAAAAACGGT

GCCCTTTCGCTGGTGCCTTACGCCATGACCCCAGAGAGGTTTGTTGACTACGCCAGGCAAGCAGAAGAGGCCTATGGAGCCTCCCACTACCCAGCTGCCA

ATCCGTCTGTCATCGTTTGCTGCCCCACCTCTGAAAACGATAGTGGGGTGCCCTGTAACCCCTTGTATCCTGAACACAGGTCCAATCTTCCCCAAGTGGA

GTTTCACTCATACTTGAAAGGCCCTGCCCAGGAAGGGTTTGTTTCCACATTGAATGGCGACAGCCACATTTCAGAGCATCCTGCAGAAAATCCTTTGAGC

CTTGCAGAAAAGAGCAGATTGCATGAAGAGTGCATTCAGTCCCCCGTGGTGGAAACGGTCCCCGTTTAGTTGCTTAAATTATTCTATTACAGGACCAAGT

CTTCTATTTAAGGCACTGTATTGCCTTTGCTGGGCTCATCGTTGTTTAAACCTGAAGGCCAAGAGTTATGTGGACTGTGATTAATCTTCCAGACAGTATT

TCCTTCCTTCCTTTCTAGCTTCCCAACTGTGGCGTGGCACAAATACAGTCGCTATGGGGATTTTAAACGATTTTGAACTGTTTTGATAGAAAAATGCTAA

ATTTAAAAAAAATGCATATCTTACAGTTGCCTACCTGTCAAACTGTGTGAAACCTGCCAAGCTATGCAGATCATAGCTCCAAGTTTTAGATTATCGGGCC

TGTGCAAGATTGTTAACTAAGACTAGAAAACAAGCAGATTTAGAGTCCTAATTTTTCGATATATCTGAAGATGATGGTGACTTTTTAATGTAAAAGTAAT

TATTGTAAGAAAAAAAAAGATTGAATCGTTTCTTGTGTATTTTATTTATGGTAGTTTAGAAGTCATGCTTTGAAGAAAATGAACAGCATGTTCATTGAAG

CTGAAGACGTGTTAGCTAGCACCACAGAGCATGCCCAGACGATTGCATCTGGAATCCACCCACATTTTTACGATCATGACTCAGCAGATTTGCAAATACT

TTCTTAAGGATGAAATAGGCCTATTTTTGCTATTTGGGACAAATGAGTCTATACGTGCAGGTCCTTATGCAGTTTTCTCTCACGTTAAGAGTTAGGACAA

TCCTCTGGCGAGGGTCTAGTCCTCCGCTCTCCCTCAGCTGAGATAGACGGAATTGCCTTTCCTTTGTTAAACAGTGTCATCTTGTTTCTTAGCTTGGACA

GCACCTTTAAACTCAACTCCCTCCTTCAGAATGCACTTTAGTGCCCCTTCACGGTACCTCGTGTGGGATGGGGTCTCAGAAGGCTTTGAAATATTTTTTT

TTTAATTATTAAAAAAAAGTAACTAAGGTTCATACAATAGAGAGAGAGGATTCTTCCAATGACATGAAGGAAAATGACTTGTTTCTTGTTTTCCTTCACC

GCTCTAGGACCTAACTCAATCCTTACAGCGAGAAGGCTGGGGGTGGGGGCAGAGCCTCAGCACCCCATCACCCTCTACAAATGCAAAAATGTGTAATGCC

ACTTAATGGCTAGCTGATTCAAGGCAGGCCTGGGCTCACTGACTCATTAGGCTTCGTTTTCTGGAGCTTTTTTTAAAAAAAAAGTCTGTCTTGCCTGGGG

TAGTCAGCAGCACATCCCAGAATGCATTGCGAAGGCAGCCACCTCACCTTCTCTTCCTTAGTAAAGAGAACGAATAGAAAGGAGACACTCCCCGCCCGCC

TGCTTCGAGCCTCACCTCAGAGGACTTGGAGCAACTTCTTTCCCATCAGCTTAAGCAGCTATAGAACGAGTGTTACGGTTTCCCCCATGCAGTTATTCTG

CTGAATCTGTTTTCCAGTTTTGACATTGTATTGTGGCATCATTTCTCATACTTTATGGCTATTTAAAAACGCAGACACACCCCTACTTCGTAGTAACGGC

GTCTTCTAAGTTTTTTATGCCTCCTTGATGTGGGCATTTGAATAACTTTCGGATTTCAGTTCCTTACAGAATACTATTTGATCTGACGAGGCTTGAATGT

GCTTCAGAGTCCTCTGGTGGGAAGCCGCTACTTAAACTCCATGTGGGGAAAGTACGTTCGCTTGTGGAGTTGTTTCTTCTCTAAACCACCTCAAGACTAA

ATAAATCAACGCTAATTTTTACTACCATTAAAAGGACTTTGGGTTTGTCATGCTATTGAAAGCAGTAATGGGGGCTGACTACTCCTTTTGGTTGACCGGT

GGGGCTAATCTGGTGGGAATTCTGTGGTAATATGTCCAGAGTTCTCTGCAGCGTTGCCATCAGTAGCATTTGGTTTCCAGTTAGGCTGCCTCCTGCCCAC

ACAATCTAAAGGGCAGGGGCTCAGAGAAGAAATGACAAAAAGCTATTGTTCCTTCGTTCAAGCTAATGAAAGAATTCTGTGTTCCATATTTGCTGGGCCA

TTCCAACCTCTGGAAGTATCTCCTGGTGAGACACTCGCAGGCTATTCTTGGAACAGAGTGTGGGGCGGCCCCGGGTAATCCTGACTAAGGTAGAGTTGAT

TTGGTGAATGACAGTCCACTTCCTGGATCCTCAGAGATGTTTCTTTCAGTCCAGCTTTATTTTCACAAAGTTTGGAGCATTTTTGTATCTCATTTGGTTT

TTCTTTTGTAGTCCTTGCTTTTCAGAAACAGAGCTTTCTTCCTTTCTCTATTCAAGTGAGATAAAAAGTTTCACTCTGCTAAGGATAATTACCTTTCTAA

GCATGAAAACAGACATGCTAAGTTTTCACATCCCTAAGTAGACATCCCTCATGAATCAGAATCGTTACAGGCCATCTATTTTAGCAACAATAGCAAATCA

AACCCTACTTGCCTTATCTTTATTAGACACACACAAACACAGAATACACATACAACATCCTCTAGAGAGGGGCAGATTGTGGGCAGTAGGTAGTAATGAA

TACTGGATAGTTAGTTCCTCAAGTACAATCAGGCTCTGCTTTACCTAAAACC
Translation
 - UNI26130 - MRSQG - UNI14549 - - UNI25810 - GTCDNAAAMSGILKRKFEDVDASSPCSSARESDDEVSSSESADSGDSVNPSTSN

HFTP - UNI25810 - PSSILKREKRLRTKNVHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKLN

SLKLK MTKNGTVESEEASTLTVDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVDEKHELRAIRLSREDCGCDCRVFCDPETCTCSLA

GIKCQ VDRMSFPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQTPTLNGCHGEISAHGPSMGPVAHSVEYSIADNFEIETEPQAAVLH

LQEELDCQGDEEEEEEDGSSFCSGATDSSTQSLAPSESDEEEEEEEEEEEEEEEDDDDDKGDGFVEGLGAHTEVVPLPSVLCYSDGTAVHESHTKNASFY

ASSSTLYYQIDSHIPGTPSQLSDNYSERDTVKNGALSLVPYAMTPERFVDYARQAEEAYGASHYPAANPSVIVCCPTSENDSGVPCNPLYPEHRSNLPQV

EFHSYLKGPAQEGFVSTLNGDSHISEHPAENPLSLAEKSRLHEECIQSPVVETVPV
Transcript ENSMUST00000112395
Sequence
TTGGTTGGCTGCGGCCTGATGGATGAAGGGCGGAGTGAGCTCTTCTCAGTGTGTTCTGCTGGAGCCCAAGTACAGAGACCATATTTACAG GTCCATGTG

ACAGCTATGAGTGGAATTTTAAAGGGGACGTTGGAAGAAGCTGGCAGCGCTTCACCCTGCTCTTCTGTGCAGGAATCAGATGATGACGTTTTTAGCTGTC

ACAGTGCTGAGAGTCTTGATAGTGTCAGTGTGTCCACACCTGATCCTTTACCC - UNI26130 - GAAAAAATAAGAGGATATCAAGAGGCTGAAAGA

ATATTTTCAGAAGCATAGACTCTTCGGAGGATACTGCAGTTCATGAGATCTCAAG - UNI14549 - - UNI25810 - GTACATGTGACAACGCCG

CAGCTATGAGTGGAATTTTAAAGAGGAAGTTCGAAGATGTGGACGCCTCCTCACCATGCTCCTCTGCTCGGGAATCGGATGATGAAGTCTCCAGCAGCGA

AAGTGCTGACAGCGGGGATAGCGTCAATCCATCCACCTCAAATCACTTCACCC - UNI25810 - CTTCCTCCATCCTGAAAAGGGAGAAACGGCTGA

GGACGAAGAATGTACACTTCAGCTGTGTCACCGTGTACTACTTCACCAGGAGGCAGGGCTTCACTAGTGTGCCCAGCCAGGGTGGCAGCACTCTGGGGAT

GTCCAGTCGTCACAACAGCGTGCGCCAGTACACCCTGGGCGAGTTTGCGCGAGAGCAGGAGCGCCTGCACCGGGAGATGCTGAGAGAACACCTCCGGGAG

GAGAAACTCAACTCTCTCAAACTAAAG ATGACTAAGAATGGCACTGTAGAGTCTGAGGAAGCTAGCACCCTGACCGTGGATGACATTTCCGATGACGAT

ATTGATCTGGACAACACCGAAGTGGACGAATACTTCTTCCTACAACCCCTGCCCACAAAAAAGCGGAGAGCTCTGCTGCGCGCCTCGGGGGTGAAGAAGA

TCGACGTTGACGAGAAGCACGAACTGCGGGCCATCCGCCTTTCTCGGGAGGACTGTGGCTGTGACTGCAGAGTGTTCTGTGATCCAGAAACCTGTACCTG

CAGCCTGGCAGGCATTAAGTGTCAG GTGGATCGTATGTCTTTCCCATGTGGCTGCACTAAAGAAGGCTGTAGTAACACAGCAGGTAGAATTGAATTCAA

TCCTATCCGTGTCCGGACTCATTTTTTGCACACAATAATGAAACTTGAACTGGAGAAGAACCGAGAGCAACAAACCCCCACGCTGAATGGCTGCCACGGG

GAGATAAGCGCCCATGGTCCTTCCATGGGCCCTGTCGCTCACTCTGTAGAATATTCCATCGCAGACAATTTCGAGATTGAAACCGAACCCCAGGCTGCTG

TGCTGCACCTACAGGAGGAACTGGACTGCCAAGGAGATGAGGAGGAAGAGGAGGAGGACGGAAGCAGTTTCTGCAGTGGAGCCACTGATTCTAGCACCCA

AAGCCTGGCTCCCAGTGAATCGGATGAGGAAGAGGAGGAGGAGGAAGAAGAAGAGGAAGAGGAGGAGGAAGATGACGACGACGACAAGGGAGATGGCTTT

GTAGAAGGGCTCGGAGCCCATACGGAGGTCGTCCCCCTTCCGTCTGTCCTTTGTTACTCTGATGGCACCGCAGTTCATGAAAGCCACACAAAAAATGCTT

CATTTTACGCTAGCTCTTCAACTCTCTACTACCAAATAGATAGTCACATCCCAGGAACTCCTAGCCAGCTCTCTGACAACTATTCTGAAAGAGATACTGT

CAAAAACGGTGCCCTTTCGCTGGTGCCTTACGCCATGACCCCAGAGAGGTTTGTTGACTACGCCAGGCAAGCAGAAGAGGCCTATGGAGCCTCCCACTAC

CCAGCTGCCAATCCGTCTGTCATCGTTTGCTGCCCCACCTCTGAAAACGATAGTGGGGTGCCCTGTAACCCCTTGTATCCTGAACACAGGTCCAATCTTC

CCCAAGTGGAGTTTCACTCATACTTGAAAGGCCCTGCCCAGGAAGGGTTTGTTTCCACATTGAATGGCGACAGCCACATTTCAGAGCATCCTGCAGAAAA

TCCTTTGAGCCTTGCAGAAAAGAGCAGATTGCATGAAGAGTGCATTCAGTCCCCCGTGGTGGAAACGGTCCCCGTTTAGTTGCTTAAATTATTCTATTAC

AGGACCAAGTCTTCTATTTAAGGCACTGTATTGCCTTTGCTGGGCTCATCGTTGTTTAAACCTGAAGGCCAAGAGTTATGTGGACTGTGATTAATCTTCC

AGACAGTATTTCCTTCCTTCCTTTCTAGCTTCCCAACTGTGGCGTGGCACAAATACAGTCGCTATGGGGATTTTAAACGATTTTGAACTGTTTTGATAGA

AAAATGCTAAATTTAAAAAAAATGCATATCTTACAGTTGCCTACCTGTCAAACTGTGTGAAACCTGCCAAGCTATGCAGATCATAGCTCCAAGTTTTAGA

TTATCGGGCCTGTGCAAGATTGTTAACTAAGACTAGAAAACAAGCAGATTTAGAGTCCTAATTTTTCGATATATCTGAAGATGATGGTGACTTTTTAATG

TAAAAGTAATTATTGTAAGAAAAAAAAAGATTGAATCGTT
Translation
  - UNI26130 -  - UNI14549 - - UNI25810 - MSGILKRKFEDVDASSPCSSARESDDEVSSSESADSGDSVNPSTSNHFTP - UNI25

810 - PSSILKREKRLRTKNVHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKLNSLKLK MTKNGT

VESEEASTLTVDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVDEKHELRAIRLSREDCGCDCRVFCDPETCTCSLAGIKCQ VDRMSF

PCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQTPTLNGCHGEISAHGPSMGPVAHSVEYSIADNFEIETEPQAAVLHLQEELDCQGDEE

EEEEDGSSFCSGATDSSTQSLAPSESDEEEEEEEEEEEEEEEDDDDDKGDGFVEGLGAHTEVVPLPSVLCYSDGTAVHESHTKNASFYASSSTLYYQIDS

HIPGTPSQLSDNYSERDTVKNGALSLVPYAMTPERFVDYARQAEEAYGASHYPAANPSVIVCCPTSENDSGVPCNPLYPEHRSNLPQVEFHSYLKGPAQE

GFVSTLNGDSHISEHPAENPLSLAEKSRLHEECIQSPVVETVPV
Transcript ENSMUST00000112394
Sequence
CCCACTCCAGGTACATGTGACAACGCCGCAGCTATGAGTGGAATTTTAAAGAGGAAGTTCGAAGATGTGGACGCCTCCTCACCATGCTCCTCTGCTCGGG

AATCGGATGATGAAGTCTCCAGCAGCGAAAGTGCTGACAGCGGGGATAGCGTCAATCCATCCACCTCAAATCACTTCACCC - UNI25810 - CTTCC

TCCATCCTGAAAAGGGAGAAACGGCTGAGGACGAAGAATGTACACTTCAGCTGTGTCACCGTGTACTACTTCACCAGGAGGCAGGGCTTCACTAGTGTGC

CCAGCCAGGGTGGCAGCACTCTGGGGATGTCCAGTCGTCACAACAGCGTGCGCCAGTACACCCTGGGCGAGTTTGCGCGAGAGCAGGAGCGCCTGCACCG

GGAGATGCTGAGAGAACACCTCCGGGAGGAGAAACTCAACTCTCTCAAACTAAAG ATGACTAAGAATGGCACTGTAGAGTCTGAGGAAGCTAGCACCCT

GACCGTGGATGACATTTCCGATGACGATATTGATCTGGACAACACCGAAGTGGACGAATACTTCTTCCTACAACCCCTGCCCACAAAAAAGCGGAGAGCT

CTGCTGCGCGCCTCGGGGGTGAAGAAGATCGACGTTGACGAGAAGCACGAACTGCGGGCCATCCGCCTTTCTCGGGAGGACTGTGGCTGTGACTGCAGAG

TGTTCTGTGATCCAGAAACCTGTACCTGCAGCCTGGCAGGCATTAAGTGTCAG GTGGATCGTATGTCTTTCCCATGTGGCTGCACTAAAGAAGGCTGTA

GTAACACAGCAGGTAGAATTGAATTCAATCCTATCCGTGTCCGGACTCATTTTTTGCACACAATAATGAAACTTGAACTGGAGAAGAACCGAGAGCAACA

AACCCCCACGCTGAATGGCTGCCACGGGGAGATAAGCGCCCATGGTCCTTCCATGGGCCCTGTCGCTCACTCTGTAGAATATTCCATCGCAGACAATTTC

GAGATTGAAACCGAACCCCAGGCTGCTGTGCTGCACCTACAGGAGGAACTGGACTGCCAAGGAGATGAGGAGGAAGAGGAGGAGGACGGAAGCAGTTTCT

GCAGTGGAGCCACTGATTCTAGCACCCAAAGCCTGGCTCCCAGTGAATCGGATGAGGAAGAGGAGGAGGAGGAAGAAGAAGAGGAAGAGGAGGAGGAAGA

TGACGACGACGACAAGGGAGATGGCTTTGTAGAAGGGCTCGGAGCCCATACGGAGGTCGTCCCCCTTCCGTCTGTCCTTTGTTACTCTGATGGCACCGCA

GTTCATGAAAGCCACACAAAAAATGCTTCATTTTACGCTAGCTCTTCAACTCTCTACTACCAAATAGATAGTCACATCCCAGGAACTCCTAGCCAGCTCT

CTGACAACTATTCTGAAAGAGATACTGTCAAAAACGGTGCCCTTTCGCTGGTGCCTTACGCCATGACCCCAGAGAGGTTTGTTGACTACGCCAGGCAAGC

AGAAGAGGCCTATGGAGCCTCCCACTACCCAGCTGCCAATCCGTCTGTCATCGTTTGCTGCCCCACCTCTGAAAACGATAGTGGGGTGCCCTGTAACCCC

TTGTATCCTGAACACAGGTCCAATCTTCCCCAAGTGGAGTTTCACTCATACTTGAAAGGCCCTGCCCAGGAAGGGTTTGTTTCCACATTGAATGGCGACA

GCCACATTTCAGAGCATCCTGCAGAAAATCCTTTGAGCCTTGCAGAAAAGAGCAGATTGCATGAAGAGTGCATTCAGTCCCCCGTGGTGGAAACGGTCCC

CGTTTAGTTGCTTAAATTATTCTATTACAGGACCAAG
Translation
MSGILKRKFEDVDASSPCSSARESDDEVSSSESADSGDSVNPSTSNHFTP - UNI25810 - PSSILKREKRLRTKNVHFSCVTVYYFTRRQGFTSVP

SQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKLNSLKLK MTKNGTVESEEASTLTVDDISDDDIDLDNTEVDEYFFLQPLPTKKRRA

LLRASGVKKIDVDEKHELRAIRLSREDCGCDCRVFCDPETCTCSLAGIKCQ VDRMSFPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQ

QTPTLNGCHGEISAHGPSMGPVAHSVEYSIADNFEIETEPQAAVLHLQEELDCQGDEEEEEEDGSSFCSGATDSSTQSLAPSESDEEEEEEEEEEEEEEE

DDDDDKGDGFVEGLGAHTEVVPLPSVLCYSDGTAVHESHTKNASFYASSSTLYYQIDSHIPGTPSQLSDNYSERDTVKNGALSLVPYAMTPERFVDYARQ

AEEAYGASHYPAANPSVIVCCPTSENDSGVPCNPLYPEHRSNLPQVEFHSYLKGPAQEGFVSTLNGDSHISEHPAENPLSLAEKSRLHEECIQSPVVETV

PV

For any suggestions or comments, please send an email to unitrap@crg.es