Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044707 (Ccnjl)
Chromosomal location
Chr 11: 43342286 - 43400499 (+)
Description
cyclin J-like Gene [Source:MGI (curated);Acc:Ccnjl-001]
RefSeq_dna
NM_001045530 
RefSeq_peptide
NP_001038995.1 
UniGene
Mm.247595 
MGI
MGI:2685723 
Uniprot/SWISSPROT
Q5SRT8 
Uniprot/SPTREMBL
B2RTH5 
Human Ortholog
ENSG00000135083 (CCNJL)
Omim not available
UniTrap UNI27276
Vector Insertion
Chr 11: 43342470 - 43342856
Public Clones not available
Private Clones OST65197 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19134
Vector Insertion
Chr 11: 43342962 - 43370056
Public Clones not available
Private Clones OST403756 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000050574
Sequence
GAACTGCGAGCCGCGGCGGGACCGAGCGCACGCAGGGGCGCGCCGGTGGCCGGGCGGGACGGGCTGCAGAGGCAGCGGTCGCGAGCACGCGAGGCCAGGG

ACCGGGCGGCCATCGGAGGGCACTACGTACCCGGTGCGGGAAGGGACCCACCACCCGCGGCCCCCCACGCCGGGACAGCGATGC - UNI27276 - GG

TGCGCCCCGAGATCCCGGTAGCTTCATAACTGCGGCGGTGATGGATGAGCCGTGGTGGGAAGGGCGCGTCGCCTCGGACGTACACTGCACTCTGCGCGAG

AAG - UNI19134 - GAACTGAAGCTGCCCACCTTCCGTGCCCACTCCCCGCTCCTGAAGAGCCGTCGATTCTTTGTAGACATTCTGACCCTGCTGAG

CAGACACTGCCATCTCTGCCCCTCGGCCCGGCACCTGGCCATCTACCTTCTGGACCACTTCATGGACCAGTACAACATCACCACCTCCAAGCAGCTGTAT

ACTGTGGCTGTCTCCTGCCTCCTGCTGGCAA GTAAGTTTGAAGACAGGGAAGACCGCGTGCCTAAATTGGAGCAGATAAACAATACAAGGATCCTGAGC

AGCCAAAACTTCTCCCTCACCAAGAAGGAGCTGCTGACCACAGAACTTCTGCTCCTGGAGGCTTTCAGCTGGGACCTTTGCCTGCCCACGCCCGCCCACT

TTCTGGACTACTACCTCTTGGCCTCCATCAGCCAGAAGGACCACCACTGCCACGCCTGGCCCACCACCTGCCTCCGAAAGACCAAAGAGTGCCTCAAGGA

GTATGCTCACTACTTCCTAGAAGTTACCCTGCAAG ATCATATATTTTACAAATTCCAGCCTTCCGTGGTTGCTGCAGCCTGTGTTGGGGCCTCCAGGAT

CTGCCTTCAGCTGTCTCCCTACTGGACCAGAGACTTGCAGAGGGTCTCGAGCTACTCCCTAGAGCATCTCAGCACGTGTATCGAAATCCTGCTGGT AGC

CTATGACAATGTCCTCAAGGATGCCGTTGCAGTCAAGAGCCAGACGCTGGCCATGGTGCCGGGCTCATCATCAGCTCCCGCCCAAGTGCTGTTCCAACCG

CCCACCTACCCGACTCTCAGCCAGCCACCGCCAACAACTCTAGCCCAGTTCCAGAGTCCAGCGCAGGACTTGTGCTTGGCATATCGGGACTCGTTGCAGG

CCCACCGTTCAGGGGGCCTGCTCTCAGGAGACACTGGTCCATCCCTCCACACGCCATACCCAACCCTCCAGCCCTTGGATATGTGTCCTGTGCCCGTCCC

TGCATCCCTTAGCATGCAGATGGCCATAGCAGCTGAACCCAGGCACTGCCTTACGGCCTCCTACGGAAGCAGCTACTTCAGCGGCAGCCATATGTTCCCT

GCAGGCTGTTTCGACAGCTAGGCCACACTTGGACCACAGGGAGAATCCTGAAAGATCCAGACAAAGGAAGTAAATACCTAAGAGGAGAGCTCATCCAGGT

GGGACAGAGAACCTAGTACCTTTAAGTAGAGAGGGTCTTTGCTCTTTTTAAAAACAAATCAACAGAACAAAACATCCAGGGATACGCCCAACAGCATCTC

TCTGGGAAATCCTTCCGTGTATGCCTGGAGGACAAAGACATGGCTCTGTGACCTTTCCCCTGAACTGCGGATCCGATGGAGCATATCAGACTTGGACAGT

GAGGACTGCATACATCCGGACTTCTCAAAGACTACTTTTCATAGCCATACCACTGAAAAAGAAGGGGCACCTGACACGTCTGTCTATGTCCCTAGAAGAT

CCATCCTGAGTGTCTTTCTCTCCCTAGCTCCACTCCAAGGGTCCCATGGCCCGTGTTTAGGCCTGAGCACTGAGCCCATAAGGCACAGTAAGTGGCTATC

TTGCCTGCCCTTTGTTTTTGAACCCCAAATCTTTCCATTCTTCTAGCTATTTCACATGCTGCTGCTTCCTGGAACAGTCTAGCTTTCTATCCTGAAAAAA

AAAAAAAAAATCTTGTTTACATACCGTGTCAGGGATTTTTATGATACTTGAAAATTCTGTAGGAGCAAAAAGTTTGAATTGCCACACTGTCTGTCTGTCC

CACATGAGGCTGTATCTTTTATTAATCCAACTTGGGACCAACTGGTGGATAACAACAGCGAGGGATACCACCTCTCAGGCTCACTTTGCAAGAGTCCACC

CCTGGGATGCAAGTGTTCGCCTATTGGACTTGGATTACTGCCCCCTGGTGGGGGAATGTTGTTTGAAGGAGACAAAGGTTTGAACTGGCCCTTACTTCCC

TCCACCACTTGCTTTTAGTGCTGAGGTTAAACTGATCCCAGACTTGAGTTTGGCCAATACTAAAGGGTAGTCATACTGTGGAATATTAGAAAAGTGGGGA

GGAAGGGACTAACGTGGTATATGACACCAGCGTTGACAGGCAAGAGATTGCTAGAGCAAAAGCCCATGTCTGGGATTTGCAGTGCGAGGGCTCAGGAACA

CTGTCACCATGTGCAATATGTTATGACTATGACTCACAGCCTGTGCTTAAGATGTTCTTGTGGTTGGGTTTTTTGGTTTGGTTTGGTTTTTGGGGTTTTT

TTGTTTGTTTGTTTTTTTCTTGGTCAGGGGACATGCTGTTCACCCATCAGAATTGGAAGGGAGGTGCAAAAGACCACAGAAACAAATTGTAATTTAGTTT

TTG
Translation
 - UNI27276 - MDEPWWEGRVASDVHCTLREK - UNI19134 - ELKLPTFRAHSPLLKSRRFFVDILTLLSRHCHLCPSARHLAIYLLDHFMDQ

YNITTSKQLYTVAVSCLLLAS SKFEDREDRVPKLEQINNTRILSSQNFSLTKKELLTTELLLLEAFSWDLCLPTPAHFLDYYLLASISQKDHHCHAWPT

TCLRKTKECLKEYAHYFLEVTLQD DHIFYKFQPSVVAAACVGASRICLQLSPYWTRDLQRVSSYSLEHLSTCIEILLV VAYDNVLKDAVAVKSQTLAM

VPGSSSAPAQVLFQPPTYPTLSQPPPTTLAQFQSPAQDLCLAYRDSLQAHRSGGLLSGDTGPSLHTPYPTLQPLDMCPVPVPASLSMQMAIAAEPRHCLT

ASYGSSYFSGSHMFPAGCFDS

For any suggestions or comments, please send an email to unitrap@crg.es