Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044768 (D1Ertd622e)
Chromosomal location
Chr 1: 99540480 - 99558651 (-)
Description
Uncharacterized protein C5orf30 homolog  [Source:UniProtKB/Swiss-Prot;Acc:Q8VEB3]
RefSeq_dna
NM_133825 
RefSeq_peptide
NP_598586.1 
UniGene
Mm.392886 
MGI
MGI:1277184 
Uniprot/SWISSPROT
Q8VEB3 
Human Ortholog
ENSG00000181751 (C5orf30)
Omim not available
UniTrap UNI33891
Vector Insertion
Chr 1: 99551176 - 99558543
Public Clones IST13115A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22195
Vector Insertion
Chr 1: 99540479 - 99542939
Public Clones not available
Private Clones OST303637 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000053033
Sequence
TTCCCGGCCTCGCCTCCGCAGCCCGCGGGAGGAGGCGGGAAGGCGGGCGGAGGCGGGGGAGGAGGCGGGACTACGGCGGGCCGTAGCTGGCGCCGAGCGC

GGTGGGAGAGCAGCGGGTACCCGGCTGGCTCCGCTGGCGGCCTCTGCCCACACCTCGGCGCCGCAGCCCCGCGCCTCGCCCGCCCTTGGCTTCGGGGTCT

GCGGCTGCCGGCCATAGAGGAACCGGCGGAACCCTGGACGACCG - UNI33891 - TATCTGGACTAGAACAGAAAACTTATTATGCCTGTGCTCCCT

TGGGACACTTTGGAACTTGCACAGTGACATCATCTGGGATTTAGTCTG - UNI22195 - - UNI33891 - GCGTGTGCAGCCTGGTGCCTAAGAT

GGAAGTAGATATAAATGGGGATTCCAGAAGTACCCTGACCACCCTGCCCTTGCCTGTGGCTGAGGGAAGCTCTCCAGGAAAAGCAGAGGCAGAGAAACCC

CGCTGCTCTAGCACACCCTGCTCGCCCATGCGCCGGACTGTGTCTGGTTATCAGATCCTCCACATGGACTCTAACTACTTGGTTGGCTTCACCACTGGTG

AGGAACTCCTGAAGTTAGCCCAGAAGTGCACAGGAGGGGAAGACAGCAAGGGAGAAGCCATGCCCGCCTTGCGCGCTAAACAGCTGGACACGGGACTCGC

GCGTTCCTCTCGTCTGTATAAAACTAGAAGTAGGTACTATCAGCCATATGAGATCCCAGCGGTTAATGGCAGGAGGCGAAGGCGGATGCCCAGCTCAGGA

GACAAGTGCACCAAACCCTTACCTTATGAACCTTATAAGGCCCTCCATGGGCCCTTGCCTCTATGTCTTCTTAAAGGTAAGAGGGCTCACTCCAAATCTC

TGGACTACCTCAATCTAGATAAAATGAACATCAAGGAGCCAGCTGACACGGAAGTGCTACAGTACCAGCTTCAGCACCTGACCCTCCGAGGGGACCGAGT

GTTTGCTAGAAACAATACATGAGTGGCGTGGGCAGAGTTTAAACCACTTTAGGTCAGCCTATGCTCGGCTAGAGAAAAATCTACTGTCGTACTCTGTACA

TGACCCTTCACGTTAGAGATGGTTATATCAGCTAAGTGTTCCTGGAACATAAAAATTGTTTGGATCAAGTTTTGGATACAGGAATGAAATCACAGGTACT

TGGGGCGGGGCGGGGGGATATCATTCTAGAGCACGCAATTGCAAAGAAAACCGAATGTTGACTGTTAGTTTGCATAGCTTTTTAGCTAGGAAAAGGCTTT

GGTGCAGTAATTTCACCTTTATGAGTCTGACACCCAAATTGGGAATGTTACCTGCTTGGTTGTTGCTAACTTGGTATGATTCATTAGAAATTTATACCGA

AGTACCCAGTGCTTCTTGGATCTCTGTATTTTACTATAAAATGTATGTAATGATTTGTCTTATGAAATTTAAAGCTTGAACACGGCTGAACTGGACCACT

TTTTATTTTTAAATATTGAGTTTAAATATTTTATAACTGGTTTTGCACTGAAAACAATTAACATTTCAGATAATTAAGAGAATAATCTTTCTTCACTTGC

CTCAATAATGATATTGAGCAATGGATTTTTTTTTTTAATTTCCGCATGGAAAGTTACTGATCTTTATGGCTGTAAAATATTCCTTTCTAGCATTATTAAA

GTGTGTCTTAATAAAATTAAATTTGGGATACAAAGTATTTATTTTACGATGGGTAGCGGGTGGGGCGCTTTTCAGAATGTTTCCAATATGAAGTTTTCGT

CAGTTGGAAACATTTCCTTAGTGCTTATTATCAATTTAAATTCCACATGGAACTTGAAGACAGGGAGGATTCTCAGCACTGGGTTGTCAGTATAGTGCTG

CTTGCATCTTTACTTCTTGTAAGTGACTGCAGCTCTAGCAGAGGAGCTCCTGATTTTGACTATCAAAGGCTTAAACTGAGTATGAAGTGATACCGCTCAG

CCCAGGGTTGGGTCTTTCCAGGCTCAGTTCTCTGCAGCGAGGCACTCATCAAAACTTTAGTTCGGGATTAGCGTAGGAGCCCAACATACTCCTACAGTTT

TAATGGGCTAATCCTGGATTACCTAAGAGTTTACGTCCATCACACTGGTTTGATTTGTTGCTAAAGAAATAATTCCTTGCCTTTAGTAACAGAAGCAGCT

CAACTATTCTTGACCATAAATGTATGTAACTTTCCTTTTGTAAACATTTCTATTTCTTTTACTCAGTCTTAAAGGTGCAATTTATTACTGATTTGGCATT

TCTGGCTATATAGAACTACGTAGTTTATGTTTTCTTTGGGGGCACTGTGAGTTTCTAAGGGGTTAGCAGTCTTGCTTTTAAAAATAAGAACACTTTTTAA

TTGGCGGATGGGCCATTCCTGGAACAATCGTGATTTTTCCCTCTGTCCAGAATGAATGGCAAGCTTTATTAGAGCAGAATAAGTCTTAGAAACCTCAGAA

ACTCTTCATAGAGAGACAACCGTGTTGGCAACATGTAGGAAAGAGCTTTGGAGATGCTGGCTTCCATCTTACTGAATCGATTAGAGTTTTCAATGGCTGG

AAAGTTTCTGCTGTTGTCTATTTTAAAGTAAACTGCACCTTTGTAACATATTGATGAATGATCACTAAGATTAACTATATCTATACAGTCATTAGTTTGA

CAAGTAATAGAATCCTGTCAGATGCCAAAGAGTTGGGATTTTTACATTTAATGATTAAACACCGTTATTTATTGATGATTTTCCCTCTGGAACTGTATTA

TTTCTAACTGAAATAAAAGGGTGATGTCAACATC
Translation
 - UNI33891 -  - UNI22195 - - UNI33891 - MEVDINGDSRSTLTTLPLPVAEGSSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSN

YLVGFTTGEELLKLAQKCTGGEDSKGEAMPALRAKQLDTGLARSSRLYKTRSRYYQPYEIPAVNGRRRRRMPSSGDKCTKPLPYEPYKALHGPLPLCLLK

GKRAHSKSLDYLNLDKMNIKEPADTEVLQYQLQHLTLRGDRVFARNNT
Transcript ENSMUST00000116550
Sequence
GCAGCGGGTACCCGGCTGGCTCCGCTGGCGGCCTCTGCCCACACCTCGGCGCCGCAGCCCCGCGCCTCGCCCGCCCTTGGCTTCGGGGTCTGCGGCTGCC

GGCCATAGAGGAACCGGCGGAACCCTGGACGACCG - UNI22195 - - UNI33891 - GCGTGTGCAGCCTGGTGCCTAAGATGGAAGTAGATATA

AATGGGGATTCCAGAAGTACCCTGACCACCCTGCCCTTGCCTGTGGCTGAGGGAAGCTCTCCAGGAAAAGCAGAGGCAGAGAAACCCCGCTGCTCTAGCA

CACCCTGCTCGCCCATGCGCCGGACTGTGTCTGGTTATCAGATCCTCCACATGGACTCTAACTACTTGGTTGGCTTCACCACTGGTGAGGAACTCCTGAA

GTTAGCCCAGAAGTGCACAGGAGGGGAAGACAGCAAGGGAGAAGCCATGCCCGCCTTGCGCGCTAAACAGCTGGACACGGGACTCGCGCGTTCCTCTCGT

CTGTATAAAACTAGAAGTAGGTACTATCAGCCATATGAGATCCCAGCGGTTAATGGCAGGAGGCGAAGGCGGATGCCCAGCTCAGGAGACAAGTGCACCA

AACCCTTACCTTATGAACCTTATAAGGCCCTCCATGGGCCCTTGCCTCTATGTCTTCTTAAAGGTAAGAGGGCTCACTCCAAATCTCTGGACTACCTCAA

TCTAGATAAAATGAACATCAAGGAGCCAGCTGACACGGAAGTGCTACAGTACCAGCTTCAGCACCTGACCCTCCGAGGGGACCGAGTGTTTGCTAGAAAC

AATACATGAGTGGCGTGGGCAGAGTTTAAACCACTTTAGGTCAGCCTATGCTCGGCTAGAGAAAAATCTACTGTCGTACTCTGTACATGACCCTTCACGT

TAGAGATGGTTATATCAGCTAAGTGTTCCTGGAACATAAAAATTGTTTGGATCAAGTTTTGGATACAGGAATGAAATCACAGGTACTTGGGGCGGGGCGG

GGGGATATCATTCTAGAGCACGCAATTGCAAAGAAAACCGAATGTTGACTGTTAGTTTGCATAGCTTTTTAGCTAGGAAAAGGCTTTGGTGCAGTAATTT

CACCTTTATGAGTCTGACACCCAAATTGGGAATGTTACCTGCTTGGTTGTTGCTAACTTGGTATGATTCATTAGAAATTTATACCGAAGTACCCAGTGCT

TCTTGGATCTCTGTATTTTACTATAAAATGTATGTAATGATTTGTCTTATGAAATTTAAAGCTTGAACACGGCTGAACTGGACCACTTTTTATTTTTAAA

TATTGAGTTTAAATATTTTATAACTGGTTTTGCACTGAAAACAATTAACATTTCAGATAATTAAGAGAATAATCTTTCTTCACTTGCCTCAATAATGATA

TTGAGCAATGGATTTTTTTTTTTAATTTCCGCATGGAAAGTTACTGATCTTTATGGCTGTAAAATATTCCTTTCTAGCATTATTAAAGTGTGTCTTAATA

AAATTAAATTTGGGATACAAAGTATTTATTTTACGATGGGTAGCGGGTGGGGCGCTTTTCAGAATGTTTCCAATATGAAGTTTTCGTCAGTTGGAAACAT

TTCCTTAGTGCTTATTATCAATTTAAATTCCACATGGAACTTGAAGACAGGGAGGATTCTCAGCACTGGGTTGTCAGTATAGTGCTGCTTGCATCTTTAC

TTCTTGTAAGTGACTGCAGCTCTAGCAGAGGAGCTCCTGATTTTGACTATCAAAGGCTTAAACTGAGTATGAAGTGATACCGCTCAGCCCAGGGTTGGGT

CTTTCCAGGCTCAGTTCTCTGCAGCGAGGCACTCATCAAAACTTTAGTTCGGGATTAGCGTAGGAGCCCAACATACTCCTACAGTTTTAATGGGCTAATC

CTGGATTACCTAAGAGTTTACGTCCATCACACTGGTTTGATTTGTTGCTAAAGAAATAATTCCTTGCCTTTAGTAACAGAAGCAGCTCAACTATTCTTGA

CCATAAATGTATGTAACTTTCCTTTTGTAAACATTTCTATTTCTTTTACTCAGTCTTAAAGGTGCAATTTATTACTGATTTGGCATTTCTGGCTATATAG

AACTACGTAGTTTATGTTTTCTTTGGGGGCACTGTGAGTTTCTAAGGGGTTAGCAGTCTTGCTTTTAAAAATAAGAACACTTTTTAATTGGCGGATGGGC

CATTCCTGGAACAATCGTGATTTTTCCCTCTGTCCAGAATGAATGGCAAGCTTTATTAGAGCAGAATAAGTCTTAGAAACCTCAGAAACTCTTCATAGAG

AGACAACCGTGTTGGCAACATGTAGGAAAGAGCTTTGGAGATGCTGGCTTCCATCTTACTGAATCGATTAGAGTTTTCAATGGCTGGAAAGTTTCTGCTG

TTGTCTATTTTAAAGTAAACTGCACCTTTGTAACATATTGATGAATGATCACTAAGATTAACTATATCTATACAGTCATTAGTTTGACAAGTAATAGAAT

CCTGTCAGATGCCAAAGAGTTGGGATTTTTACATTTAATGATTAAACACCGTTATTTATTGATGATTTTCCCTCTGGAACTGTATTATTTCTAACTGAAA

TAAAAGGGTGATGTC
Translation
 - UNI22195 - - UNI33891 - MEVDINGDSRSTLTTLPLPVAEGSSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLVGFTTGEELLKL

AQKCTGGEDSKGEAMPALRAKQLDTGLARSSRLYKTRSRYYQPYEIPAVNGRRRRRMPSSGDKCTKPLPYEPYKALHGPLPLCLLKGKRAHSKSLDYLNL

DKMNIKEPADTEVLQYQLQHLTLRGDRVFARNNT

For any suggestions or comments, please send an email to unitrap@crg.es