Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044788 (Fads6)
Chromosomal location
Chr 11: 115144681 - 115158828 (-)
Description
fatty acid desaturase domain family, member 6 Gene [Source:MGI (curated);Acc:Fads6-001]
Human Ortholog
not available
Omim not available
UniTrap UNI36451
Vector Insertion
Chr 11: 115147431 - 115158019
Public Clones IST15061E3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000056153
Sequence
TCCTCGCTTGTCCCCAGCTCGGTGAGTCCAGGGAACCCATGGAGACCGTTCGTAGTGCGCCTCCGGGGGACGGCGCTGCTGAGGCGCTGCTGAAAGAGCT

GGAGCGTCAGGTGCAGGATGTGGTGCGGGCGAGCTCGTGGTGGGAGCGCCACGGTGTGGACTGCGCCATCCTCGCTCTCAGCCTGCTCGCCTTGCCGGCA

G - UNI36451 - GGTTCCTGTGCCTACGCGCCCATAATATCCTGGCCTTTGCCACGGGCATCACAATCTTGGGTGTGTGCCATTATACACTCACCGT

CAAGGGCAGCCACCTGGCCACTCACAGTGCCCTCACAGAGTCCAAACGCTGGAGCAAGATCTTGATGATTTTCTTTTTGGAG - UNI36451 - GTGT

GCACAGCCTTTTCTGCAGAGTTCGCCAAATTCAACCACGTGAATCTGCACCACGTTTACACCAACGTGGTGGGTCTGGGCGATTCAAGCACGTGGAAGGT

GCCTCTCCTCAACCGCTACGTTTACATGTTCCTTGGGCCGCTTTTGGTCCCCATCATAACGCCGCTGGTAGCTCTTG - UNI36451 - AGCATTTGA

GGAAGGAAGAGCCGAGGACTGCACTGCGGACTTTGGGCTTCATCTGCCTGGGCCTTTACTCTCAGTACTGGCTGTTCATGAATGTGTCAGGCTTCAAGAA

CCCCAGTTCAGCACTGGCCTGCATGCTGCTCACCAGATCCCTGCTGGCCCACCCTTATCTCCATGTCAATATCTTCCAG CACATCGGACTGCCTATGTT

CTCCCCGGACAAGAAGCCCAGGAGGATCCACATGATGACCCTGGGGGTTCTGAACCTGCCACGGCAGCTGGTGTTGGACTGGGCATTCGGCCACTCCCTC

ATCAGCTGCCACGTGGAGCACCACCTCTTCCCTTGGCTCTCTGACCACATGTGCTTGAAG GTGAAGCCCTTGGTGTCGAAGTTTCTCCACGAGAAGCAG

CTGCCTTACAATGAAGACTCATACCTGGCTCGATTCCAGCTGTTCCTCAGCCGCTATGAGGAGTTCATGGTGCATGTCCCGCCCATCACTGAGCTGGTGG

GGGTGCAATGAAGGCTGGACCCCCTCCCTCGCCCAGTCCTGGCCCTCCTGTACTGCTGGCCCTTGGGGAGGGGGTGCGGACTGGTGGACCTGGCACCGTC

CTGGGATTTGAGTTAAGGGAGACTGTTGGGAGAAGAAATGGAATCAGTTC
Translation
METVRSAPPGDGAAEALLKELERQVQDVVRASSWWERHGVDCAILALSLLALPAG - UNI36451 - GFLCLRAHNILAFATGITILGVCHYTLTVKG

SHLATHSALTESKRWSKILMIFFLE - UNI36451 - VCTAFSAEFAKFNHVNLHHVYTNVVGLGDSSTWKVPLLNRYVYMFLGPLLVPIITPLVALE

 - UNI36451 - EHLRKEEPRTALRTLGFICLGLYSQYWLFMNVSGFKNPSSALACMLLTRSLLAHPYLHVNIFQ HIGLPMFSPDKKPRRIHMMTLG

VLNLPRQLVLDWAFGHSLISCHVEHHLFPWLSDHMCLK VKPLVSKFLHEKQLPYNEDSYLARFQLFLSRYEEFMVHVPPITELVGVQ
Transcript ENSMUST00000100232
Sequence
TCCTCGCTTGTCCCCAGCTCGGTGAGTCCAGGGAACCCATGGAGACCGTTCGTAGTGCGCCTCCGGGGGACGGCGCTGCTGAGGCGCTGCTGAAAGAGCT

GGAGCGTCAGGTGCAGGATGTGGTGCGGGCGAGCTCGTGGTGGGAGCGCCACGGTGTGGACTGCGCCATCCTCGCTCTCAGCCTGCTCGCCTTGCCGGCA

G - UNI36451 - GGTTCCTGTGCCTACGCGCCCATAATATCCTGGCCTTTGCCACGGGCATCACAATCTTGGGTGTGTGCCATTATACACTCACCGT

CAAGGGCAGCCACCTGGCCACTCACAGTGCCCTCACAGAGTCCAAACGCTGGAGCAAGATCTTGATGATTTTCTTTTTGGAG - UNI36451 - GTGT

GCACAGCCTTTTCTGCAGAGTTCGCCAAATTCAACCACGTGAATCTGCACCACGTTTACACCAACGTGGTGGGTCTGGGCGATTCAAGCACGTGGAAGGT

GCCTCTCCTCAACCGCTACGTTTACATGTTCCTTGGGCCGCTTTTGGTCCCCATCATAACGCCGCTGGTAGCTCTTG - UNI36451 - AGCATTTGA

GGAAGGAAGAGCCGAGGACTGCACTGCGGACTTTGGGCTTCATCTGCCTGGGCCTTTACTCTCAGTACTGGCTGTTCATGAATGTGTCAGGCTTCAAGAA

CCCCAGTTCAGCACTGGCCTGCATGCTGCTCACCAGATCCCTGCTGGCCCACCCTTATCTCCATGTCAATATCTTCCAG CACATCGGACTGCCTATGTT

CTCCCCGGACAAGAAGCCCAGGAGGATCCACATGATGACCCTGGGGGTTCTGAAC CTGCCACGTGGAGCACCACCTCTTCCCTTGGCTCTCTGA
Translation
METVRSAPPGDGAAEALLKELERQVQDVVRASSWWERHGVDCAILALSLLALPAG - UNI36451 - GFLCLRAHNILAFATGITILGVCHYTLTVKG

SHLATHSALTESKRWSKILMIFFLE - UNI36451 - VCTAFSAEFAKFNHVNLHHVYTNVVGLGDSSTWKVPLLNRYVYMFLGPLLVPIITPLVALE

 - UNI36451 - EHLRKEEPRTALRTLGFICLGLYSQYWLFMNVSGFKNPSSALACMLLTRSLLAHPYLHVNIFQ HIGLPMFSPDKKPRRIHMMTLG

VLN LPRGAPPLPLAL

For any suggestions or comments, please send an email to unitrap@crg.es