Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044807 (Zfp354c)
Chromosomal location
Chr 11: 50624610 - 50641225 (-)
Description
zinc finger protein 354C Gene [Source:MGI (curated);Acc:Zfp354c-001]
RefSeq_dna
NM_013922 
RefSeq_peptide
NP_038950.3 
UniGene
Mm.103674 Mm.471339 
MGI
MGI:1353621 
Uniprot/SWISSPROT
Q571J5 
Human Ortholog
ENSG00000177932 (ZNF354C)
Omim not available
UniTrap UNI21687
Vector Insertion
Chr 11: 50640013 - 50641080
Public Clones IST14504H11 (tigm)
Private Clones OST321056 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109135
Sequence
GGGCTTCTCCCGGTGGCGGGGCTGCTCGCGGCGTTTTGGGGGGCTCCTGGTGGAGGTGATCCTGACTGTGCTAGGAGAGAGCGTCTGGGGCCGACATCCT

CGAGACTGCTCGTGCTGAGAGTGGTGGGAGCGAGCGCCGGCGTCC - UNI21687 - GCATATTTGGTCAGCACTCGGCTCTCCTTTGGCAGAAAAAC

TAAGAAGGGAAATGGCTGTGGATTTGCTGGCTGCCCGAGGCACA GAGCCTGTGACCTTCAGGGATGTGGCCGTGTCCTTCAGCCAGGATGAGTGGTTGC

ACCTGGACCCTGCTCAGAGAAGCCTGTACCGAGAGGTGATGCTGGAGAACTACAGCAACCTGGCCTCGCTGG GGTTTCAGGCTTCAATACCTCCTGTGA

TTGGCAAGCTGCAAAAAGGGCAAGATCCCTGCATGGAAAGAGAAGCCCCTGAAGACACCTGCCTAG ATTTCGAGATTTGGCCAGAGATAGAAGCATTGC

CACCCAAACAAGATGTTCTTACTAAAGAGACATCACATGGGCTGATAAAGAATGGATCCACTAAGTGTGTTTACTGGAAAATCAGCTTTGGAGAGCTTGT

GAAAACTGAGTGCCGAGATATAGCACAGGAGCAAGAAAAGAAAGTGCATGGGCCAGGGGCAGAGTCACCCAAGGAAACCACCAGTGAAGACGGAACTCCC

ACGGGCTTCGAGCCGGAGAAACCCTTGTTCATTAGTAAAGCACTTGTCTCACAAGAGGGTGATCCTACAGAAAGTGTTCCTGCTACGTATCACACTTCAG

AGAAAGATTTACCACAGGATTTTGATCTAATGAGAAGCTTTCAAATGTACCCAGGACAAAAACCTCATGTCTGCAGTGAATGTGGCAAGGGTTTCACCCA

AAGCCTTCATCTTCTAGAGCACAAGAGGCTTCACACTGGGGAGAAGCCGTACAAATGCAGCGAGTGTGGGAAGAGCTTCAGCCATAGATCCTCCCTCCTG

GCTCACCAGAGAACCCACACCGGAGAGAAGCCGTACAAGTGCAGCGAGTGTGAGAAAGCCTTCGGCAGCAGCTCCACTCTCATCAAACACCTGAGGGTGC

ACACCGGAGAGAAACCTTACCGCTGCCGGCAGTGTGGGAAGGCCTTCAGCCAGTGTTCCACCCTCACTGTACACCAGAGGATTCACACTGGGGAAAAGCT

CTATAAATGTGCCGAGTGTGACAAGGCCTTTAACTGCAGAGCAAAGCTCCACAGACATCAGAGAATCCACACAGGGGAGAAGCCATATAAATGTGCTGAG

TGTGGGAAGGGCTACAGTCAGTTTCCATCCCTAGCCGAACACCAGAGACTCCATACTGGCGAGCAGCTTTGCCAGTGTTTGCAATGTGGGAGAACCTTTA

CACGTGTGTCTACCCTTATCGAACACCAGAGAATTCATACTGGACAGAAACCATATCAATGCAACGAATGTGGGAAGACTTTCAACCAGTATTCCTCCTT

CAATGAACATCGGAAGATTCATACCGGGGAGAAACTTTACACATGTGAAGAATGTGGGAAAGCCTTTGGCTGTAAATCAAACCTTTATCGGCATCAGAGG

ATCCATACTGGAGAGAAACCCTATCAGTGTAACCAGTGTGGAAAGGCCTTCAGCCAGTATTCATTCCTAACTGAACACGAGCGAATCCATACTGGAGAGA

AGCTCTACAAGTGTATGGAGTGTGGGAAAGCCTATAGTTACAGGTCAAACCTTTGTAGACACAAAAAAGTCCACCTTAAGGAAAGGCTGTATAAATGGAA

AGAATATGGGACACCCTTTATCTATGGCTCATCCCTTACTCCATATCAGAAATTTCTGAAAGGAGACAAGCCTGAGAACTTTAATTCATCGCTGTGATCC

AAGACAGCAACCAGAAGAGTAGTGAGTAGAATGCAAATCAAAATAGAGTCATCTTTTTTACTTGTACAGCAAATAGTTACCACTAGTCATGGACAGTGGA

TGCACAAAGAATGCTGACATCAGCAATTTAAGGACTATTACAAACAATGTTAAAAATTCGTAGAAAAAGTTTGAAAGGCCTCATTTAAAAAACAAAGCGC

ATGAGTAACTGTTGCATATAAGCATTGTTTCATGAGAGGGCCATCTCTTTCTAAGAGCTTCTGTGTTATGATTTTTCTTTTTAAGATAGTCTTTGATGTA

GTTAATAATGTGAAGAATCGTGGGGACTCAGTCCCTAAAATGGTGAGCTGTTATAGGGAGAAGTCCTTTTCATAAGGAGCCACTACAGAGGAAAAGAATA

CTTTGACTTGTTGTGTATCAACAATAAAGCTCTTTATAAATTGCCCC
Translation
 - UNI21687 - MAVDLLAARGT EPVTFRDVAVSFSQDEWLHLDPAQRSLYREVMLENYSNLASLG GFQASIPPVIGKLQKGQDPCMEREAPEDTC

LD DFEIWPEIEALPPKQDVLTKETSHGLIKNGSTKCVYWKISFGELVKTECRDIAQEQEKKVHGPGAESPKETTSEDGTPTGFEPEKPLFISKALVSQE

GDPTESVPATYHTSEKDLPQDFDLMRSFQMYPGQKPHVCSECGKGFTQSLHLLEHKRLHTGEKPYKCSECGKSFSHRSSLLAHQRTHTGEKPYKCSECEK

AFGSSSTLIKHLRVHTGEKPYRCRQCGKAFSQCSTLTVHQRIHTGEKLYKCAECDKAFNCRAKLHRHQRIHTGEKPYKCAECGKGYSQFPSLAEHQRLHT

GEQLCQCLQCGRTFTRVSTLIEHQRIHTGQKPYQCNECGKTFNQYSSFNEHRKIHTGEKLYTCEECGKAFGCKSNLYRHQRIHTGEKPYQCNQCGKAFSQ

YSFLTEHERIHTGEKLYKCMECGKAYSYRSNLCRHKKVHLKERLYKWKEYGTPFIYGSSLTPYQKFLKGDKPENFNSSL
Transcript ENSMUST00000000632
Sequence
ATGGCTGTGGATTTGCTGGCTGCCCGAGGCACA GAGCCTGTGACCTTCAGGGATGTGGCCGTGTCCTTCAGCCAGGATGAGTGGTTGCACCTGGACCCT

GCTCAGAGAAGCCTGTACCGAGAGGTGATGCTGGAGAACTACAGCAACCTGGCCTCGCTGG GGTTTCAGGCTTCAATACCTCCTGTGATTGGCAAGCTG

CAAAAAGGGCAAGATCCCTGCATGGAAAGAGAAGCCCCTGAAGACACCTGCCTAG ATTTCGAGATTTGGCCAGAGATAGAAGCATTGCCACCCAAACAA

GATGTTCTTACTAAAGAGACATCACATGGGCTGATAAAGAATGGATCCACTAAGTGTGTTTACTGGAAAATCAGCTTTGGAGAGCTTGTGAAAACTGAGT

GCCGAGATATAGCACAGGAGCAAGAAAAGAAAGTGCATGGGCCAGGGGCAGAGTCACCCAAGGAAACCACCAGTGAAGACGGAACTCCCACGGGCTTCGA

GCCGGAGAAACCCTTGTTCATTAGTAAAGCACTTGTCTCACAAGAGGGTGATCCTACAGAAAGTGTTCCTGCTACGTATCACACTTCAGAGAAAGATTTA

CCACAGGATTTTGATCTAATGAGAAGCTTTCAAATGTACCCAGGACAAAAACCTCATGTCTGCAGTGAATGTGGCAAGGGTTTCACCCAAAGCCTTCATC

TTCTAGAGCACAAGAGGCTTCACACTGGGGAGAAGCCGTACAAATGCAGCGAGTGTGGGAAGAGCTTCAGCCATAGATCCTCCCTCCTGGCTCACCAGAG

AACCCACACCGGAGAGAAGCCGTACAAGTGCAGCGAGTGTGAGAAAGCCTTCGGCAGCAGCTCCACTCTCATCAAACACCTGAGGGTGCACACCGGAGAG

AAACCTTACCGCTGCCGGCAGTGTGGGAAGGCCTTCAGCCAGTGTTCCACCCTCACTGTACACCAGAGGATTCACACTGGGGAAAAGCTCTATAAATGTG

CCGAGTGTGACAAGGCCTTTAACTGCAGAGCAAAGCTCCACAGACATCAGAGAATCCACACAGGGGAGAAGCCATATAAATGTGCTGAGTGTGGGAAGGG

CTACAGTCAGTTTCCATCCCTAGCCGAACACCAGAGACTCCATACTGGCGAGCAGCTTTGCCAGTGTTTGCAATGTGGGAGAACCTTTACACGTGTGTCT

ACCCTTATCGAACACCAGAGAATTCATACTGGACAGAAACCATATCAATGCAACGAATGTGGGAAGACTTTCAACCAGTATTCCTCCTTCAATGAACATC

GGAAGATTCATACCGGGGAGAAACTTTACACATGTGAAGAATGTGGGAAAGCCTTTGGCTGTAAATCAAACCTTTATCGGCATCAGAGGATCCATACTGG

AGAGAAACCCTATCAGTGTAACCAGTGTGGAAAGGCCTTCAGCCAGTATTCATTCCTAACTGAACACGAGCGAATCCATACTGGAGAGAAGCTCTACAAG

TGTATGGAGTGTGGGAAAGCCTATAGTTACAGGTCAAACCTTTGTAGACACAAAAAAGTCCACCTTAAGGAAAGGCTGTATAAATGGAAAGAATATGGGA

CACCCTTTATCTATGGCTCATCCCTTACTCCATATCAGAAATTTCTGAAAGGAGACAAGCCTGAGAACTTTAATTCATCGCTGTGATCCAAGACAGCAAC

CAGAAGAGTAGTGAGTAGAATGCAAATCAAAATAGAGTCATCTTTTTTACTTGTACAGCAAATAGTTACCACTAGTCATGGACAGTGGATGCACAAAGAA

TGCTGACATCAGCAATTTAAGGACTATTACAAACAATGTTAAAAATTCGTAGAAAAAGTTTGAAAGGCCTCATTTAAAAAACAAAGCGCATGAGTAACTG

TTGCATATAAGCATTGTTTCATGAGAGGGCCATCTCTTTCTAAGAGCTTCTGTGTTATGATTTTTCTTTTTAAGATAGTCTTTGATGTAGTTAATAATGT

GAAGAATCGTGGGGACTCAGTCCCTAAAATGGTGAGCTGTTATAGGGAGAAGTCCTTTTCATAAGGAGCCACTACAGAGGAAAAGAATACTTTGACTTGT

TGTGTATCAACAATAAAGCTCTTTATAAATTGCCCCTTATACAACATACCTGTGTGTATGTATGCATTTATATTCAGATCTACACATAAAGGACTTTTAT

GTATATATGGCCATGTCACCTAACAATGGGGATACAGTTAGAAAAGGCTTCATTAGGCACTTTCATGTTTATAGGAACATCATTGCATTTGCATAGCCCT

AGATAGTCTGGGTCAGCCAATCAATGTGATCTCTTGAGGTGATCAACATACCATAATTTAAAAAAAAAGTTTTTTGAGGTTATAATTACAACATTTCTCC

CTTCCCTTTCTCCAAACCCTCCTATACACTCCTCCCCACTCTCCTTCAAATCCATGGCCTCTTTTCTTACTAATTGTTATGCATGCATATATCCATACTT

TTTTATAGTAAGGGTTTTTATTGATTGGCTTGTTTATTTTAGATAGAGTTTCACTATGTAGCCTAAGATGGCCTTGAACTCATTATGTAGAGCAGGCTGG

TTTTGAACTTGCAGTCTTCCTGCATCAGCCTCCCACGTACTGGGATCAGAGGCATGAGCCATCATGCTTGGTGTAAATTTTATTAGTAGAATGTGTATAC

TCTAAGGATAAAAGTATAGTATAGCAAATGAGTAAGCTGGTAATGTAGTTTGTCACCATCACCATGTGTCATGTACTGTATATAATTGCGTGTGCCGTGA

TGTCTGGCTGCCTGCACAGAGGGTTTGTTTGCACAAATGGGCAATGCATTGTGCCTAAAGTGCTATAATAGTTAAAGAGTCACGACAGCTCTTATGTAAT

CGGACAAGTAGGAATTTTCCAGACCAGCTGTAGTCTGATGAGACCACTCTAACATATGTTGTCATTGGCTAAAACATCCTCATAGGCAAATGGCTGTATG

CACACACTCACATATATGTACATACATGTGTGTGCCAAAGTGGATACATAACACATGCAAAGAGTTTAGGACTTTTTTTTCTCTCCATAGCCCTTAATGA

TTAAAAAAGACTCAGTTTACTAATTTAGAATTTACTGTTTCAAATTAAAAATTTCCCTCAGGGGCGACTTCTTTCTGACTCCCCTATATCTGTAGTGGGC

TCTGGTGTAGGATCTAGCTGAATAGAGTCTTACAGTACTATAGAAGTTGGTCTGAGCAGACAGGTGGGCAGTCTGTCATCCAAACAATATATTACGTATT

GTAGAAGGCCATTGTTAACAAGAGTCTCCTGCTATGAACCTGTTTGCATTTTAGAATCAGAGAAACTTTTAATTTATAACCTTTTAAGAATCGAGGTCTT

CAGCTCTGATAATCTATGATAGTTATAGGTTCATTTCTATCCTCAAGGCTCAAGAACACTAATTGTTTTGTAACCTGTTCAAATATTTTTGCTAGTAATG

TAATCAGTTATCTTTAGTTTCTCCTAGCTTTGGTCTTAGTAGTGGAGTTGAGAACATGCCCCCTTCCTTCTATCTCTGATTCTATACCTGCTTCTATAAC

TACTTAAATTCTCAAAGCCAGCGACAGCCCAGATGGAGGTATCGCTTTGGTATGTTTCCGTGTGTGGTTGCCTTTTTATTACACAGCTTTTAATATTTTT

TTTCCTTGTAGTGCTGACGACTGAATCCAGGGCCTTGTGCATGCTCAGGAGGTGCTCTCCCACTGAGCTGTGTCTGCAGCCCTTAGGATTTCAGTATAAA

GTTGCAGATGAATATTTTATATTAGACAATCTACTCATTACCTTAATATTTTATAACTACCCTAGACCTAGTTCCTTTTATCTTTGACTTATCCCACTGG

TTTGTCACTTTAGAATTACTCCAGGAGCATTAATCAGACCCTTCTGTCTGAGCAAAATATTAGAATTAAGCAGGCATTCAGCACTTAATTGACTTCTTTT

GTCTCATCAGTAGTTGTATGTGTTTAAATGTATTTGCAGGAAAAATAAGACTTGAAGGGAGCCTCTGAGTGTCTTCTTGTCCCTAGTGAGCATGCTCAGT

GCCCAGTGTTTGATTCACAAATGCCATTTGCCTCCAGAGGGACTCAGGCCTCCTGGAAGAAGTGAACAGTGGCACGTTTGCAGTGAGAGGGGAAGGCAAG

TGCACAGAGAGGATAGTTCTGTGTTAGGACATCATTTTAGGGTTATTGATATGAGTAGACACAGGGACTAACTTGAAGGTGCATCCTTTGATCAAACTTT

AAGACACTTCAAACAAAATACTCATGACAGGGTTGGATATAATATTTTCTAAAGGTTATGGGGGGAAAAGCTTTTTATAACATTTGAAGAAAAGCATCCT

TTAAATATATACAAAGCAATAACAAAAGCCTTTTAGCAACTGTCATTGTCATTAAATCTAGCAAAAAGTTGATTGATGGTAAAGCCTATTTCATGAAAGA

CAATTAAGGAACATTTCCTCATCCCGAGAGTACAGCTCTGAGTCGCAAGAGACACATCTGCTTTCATCCTGAGATCTGGCAGGCAGAAGTCCCCTCCTGA

GCAGCAGCCACTGTAGCTTCTCATGAGGCCGCAGAAGCACATTTTACTATTTATGACATACTGCCAAAACCAGTTAGCGAGCATCTATGGAAATCTCTTC

TCTAGACATACCTTTCTGCTTACAAAGAATTGAGAGTAACATGTTAGATTATATGGTAATCTAGAGTTTGAGACATTGGAGATGATAATTAAGTTGTACT

TTTCAAATAGCCAATATGTTGGAACAAAAAGATGCCTGAGACAGCCACATGCAAGGTGTGATCTTTTATTGAGAAATAAAGTCAGAAAAAAAAAAAAAAC

CCTGTAAGACGTTTGAGGGATCTTTAGGAGAAATACAAAGGTGAGAATAGGTGTCAGATAACGTGGTATGGTTACTTTTCGTAGACGAGGTAAAAGTATT

GGGTTTATATTTCCCTACCATATGCATGCAAAAGTTTAAGTTGACAAGTCATAATGTCTGCAGCTTATTTTAAATTGAAACTGATCAGTGACTGTTGAAT

TGTGATCACCCCTTAAACTTGTCTGTACCTATGTTTAAATGT
Translation
MAVDLLAARGT EPVTFRDVAVSFSQDEWLHLDPAQRSLYREVMLENYSNLASLG GFQASIPPVIGKLQKGQDPCMEREAPEDTCLD DFEIWPEIEAL

PPKQDVLTKETSHGLIKNGSTKCVYWKISFGELVKTECRDIAQEQEKKVHGPGAESPKETTSEDGTPTGFEPEKPLFISKALVSQEGDPTESVPATYHTS

EKDLPQDFDLMRSFQMYPGQKPHVCSECGKGFTQSLHLLEHKRLHTGEKPYKCSECGKSFSHRSSLLAHQRTHTGEKPYKCSECEKAFGSSSTLIKHLRV

HTGEKPYRCRQCGKAFSQCSTLTVHQRIHTGEKLYKCAECDKAFNCRAKLHRHQRIHTGEKPYKCAECGKGYSQFPSLAEHQRLHTGEQLCQCLQCGRTF

TRVSTLIEHQRIHTGQKPYQCNECGKTFNQYSSFNEHRKIHTGEKLYTCEECGKAFGCKSNLYRHQRIHTGEKPYQCNQCGKAFSQYSFLTEHERIHTGE

KLYKCMECGKAYSYRSNLCRHKKVHLKERLYKWKEYGTPFIYGSSLTPYQKFLKGDKPENFNSSL

For any suggestions or comments, please send an email to unitrap@crg.es