Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044937 (BC030307)
Chromosomal location
Chr 10: 86168617 - 86239587 (+)
Description
Tetratricopeptide repeat protein GNN (TPR repeat protein GNN)(Grp94-neighboring nucleotidase) [Source:UniProtKB/Swiss-Prot;Acc:Q692V3]
Human Ortholog
not available
Omim not available
UniTrap UNI36838
Vector Insertion
Chr 10: 86168763 - 86175509
Public Clones IST12146A5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000061458
Sequence
GTCCTTTACCCTTTTCTCGTCTACGACGCGGGTCACGTTACGAGTCCTTTCAGCGCTACGTTCGCCGTCACCTTTCTTTTGGGCGTTTCTTTTCGCAAAA

GAGAAATTTGTGAGGGGTTGAATATCCGGAATGCGTTTGGATGGTG - UNI36838 - ATTGCTTAACCATTGCATCCCTTCCACAAGAAACAATTTA

AAGAAGTGATTTGAATGAAACTGACCAATTGCTTATAGCAAACACAGTTAAAAGAAGACCCAAACTGTGGACCTTGGCGACTGGGCCAGGATGGAACTTC

CTTTCTTCTAAGTGCGACATCATCCTGGAGCCGAGTGAAATGAGCGACGAGGCAAGTGAGACCGGACAAAGATACAACGGTCAACCCATTTTAAAGCGCC

AGAAACCCATCCTACCTTACATATGTTCCACTCTAGATTTTCAAGAAGAGAGAGACTTTTTGGCCAAAAGCATCTTCCCTCGGCTTAATGACATCTGCAG

CTCCCGGGGCACCTACTTCAAAGCTGTGGACTTGAGATGGTCAGCTGTGAAGGCCCATAAGTCCTTCACCAGCAACCAGTTCCGACAGTACTCCTGTCTC

CAGTCTCAACACCTGAAACTCTCCCTGGACTACGTGAACAGATGCTTCCCGTTTTTCATCGGCCTGCTGGGGCAGACCTACGGAGATTTCCTCCCCGACT

ACACACCTTTCCTGTTATCCCAAGTGAAGGACTTCGAAAGTTTATCCAAGGGAGAACAGAATCTATACATTGCTGCCAAAAATGGTTACCCTTGGGTTCT

CAAGACTCCCAACTGCAGCCTGACAGAGTTCGAGATCATCCAAGCAGTATTCCGGAAGAAATCTCAATTTCAATTTTTCTACTTCCGGACATCAAATTCG

CTGCTGCGAACTTTTAATGAGGAAGAGGAGGAGGAAGAGGAGAAGCTGTCCTCAGCATATCTGTTGAACGAACAGGGGAAGATGAAGGTTGGAAAGCTCA

AGGCTAAGATCATTGGCAAAGGGCTTCCTGTCAGATTCTACAGAGACCTGGAGGAACTGGGGGATATGGTTTGGAAGGACTGGTCGGCTGTTGTGGAAAA

GCTCTATCCATTCACTACGATCATGGGAAATATAG ACTACAAACACAGTTTCGAGAATTTGTATCATGAAGAGTTTGTGGAGAACTGCAAGCAAGTTTT

TGTTACTTCCAAGGAGTCAAACAGAACCTTTGAAATATTGGAAAGATTTGCTATAAAAGATCTTGATCTTGATCTTGATACTGACAGTACTATAGCAGGT

TCGGGGTTAGACTCCATTCTCAG AATCAATTCCCTTCCAACTTGTAAGTCCATTTTGCTCTTGTCTGGGGAACGCGGCTGTGGGAAGTCCACACTGATT

GCCAACTGGGTCAGTAATTTCCAAAGCAAACACCCCGGAGTGCTGATGATCCCATACTTTGTGGGCAGTACGTGTGAGAGCTGTGACATCATGTCTGTGA

TCCACTACTTCGTCATGGAGCTTCAGCACAGAGCCAACGGTAACCGGGCCAGCCTTATGGGCAGAAAGTGA
Translation
 - UNI36838 - MSDEASETGQRYNGQPILKRQKPILPYICSTLDFQEERDFLAKSIFPRLNDICSSRGTYFKAVDLRWSAVKAHKSFTSNQFRQYSC

LQSQHLKLSLDYVNRCFPFFIGLLGQTYGDFLPDYTPFLLSQVKDFESLSKGEQNLYIAAKNGYPWVLKTPNCSLTEFEIIQAVFRKKSQFQFFYFRTSN

SLLRTFNEEEEEEEEKLSSAYLLNEQGKMKVGKLKAKIIGKGLPVRFYRDLEELGDMVWKDWSAVVEKLYPFTTIMGNID DYKHSFENLYHEEFVENCK

QVFVTSKESNRTFEILERFAIKDLDLDLDTDSTIAGSGLDSILR RINSLPTCKSILLLSGERGCGKSTLIANWVSNFQSKHPGVLMIPYFVGSTCESCD

IMSVIHYFVMELQHRANGNRASLMGRK
Transcript ENSMUST00000075632
Sequence
GTCCTTTACCCTTTTCTCGTCTACGACGCGGGTCACGTTACGAGTCCTTTCAGCGCTACGTTCGCCGTCACCTTTCTTTTGGGCGTTTCTTTTCGCAAAA

GAGAAATTTGTGAGGGGTTGAATATCCGGAATGCGTTTGGATGGTG - UNI36838 - ATTGCTTAACCATTGCATCCCTTCCACAAGAAACAATTTA

AAGAAGTGATTTGAATGAAACTGACCAATTGCTTATAGCAAACACAGTTAAAAGAAGACCCAAACTGTGGACCTTGGCGACTGGGCCAGGATGGAACTTC

CTTTCTTCTAAGTGCGACATCATCCTGGAGCCGAGTGAAATGAGCGACGAGGCAAGTGAGACCGGACAAAGATACAACGGTCAACCCATTTTAAAGCGCC

AGAAACCCATCCTACCTTACATATGTTCCACTCTAGATTTTCAAGAAGAGAGAGACTTTTTGGCCAAAAGCATCTTCCCTCGGCTTAATGACATCTGCAG

CTCCCGGGGCACCTACTTCAAAGCTGTGGACTTGAGATGGTCAGCTGTGAAGGCCCATAAGTCCTTCACCAGCAACCAGTTCCGACAGTACTCCTGTCTC

CAGTCTCAACACCTGAAACTCTCCCTGGACTACGTGAACAGATGCTTCCCGTTTTTCATCGGCCTGCTGGGGCAGACCTACGGAGATTTCCTCCCCGACT

ACACACCTTTCCTGTTATCCCAAGTGAAGGACTTCGAAAGTTTATCCAAGGGAGAACAGAATCTATACATTGCTGCCAAAAATGGTTACCCTTGGGTTCT

CAAGACTCCCAACTGCAGCCTGACAGAGTTCGAGATCATCCAAGCAGTATTCCGGAAGAAATCTCAATTTCAATTTTTCTACTTCCGGACATCAAATTCG

CTGCTGCGAACTTTTAATGAGGAAGAGGAGGAGGAAGAGGAGAAGCTGTCCTCAGCATATCTGTTGAACGAACAGGGGAAGATGAAGGTTGGAAAGCTCA

AGGCTAAGATCATTGGCAAAGGGCTTCCTGTCAGATTCTACAGAGACCTGGAGGAACTGGGGGATATGGTTTGGAAGGACTGGTCGGCTGTTGTGGAAAA

GCTCTATCCATTCACTACGATCATGGGAAATATAG ACTACAAACACAGTTTCGAGAATTTGTATCATGAAGAGTTTGTGGAGAACTGCAAGCAAGTTTT

TGTTACTTCCAAGGAGTCAAACAGAACCTTTGAAATATTGGAAAGATTTGCTATAAAAGATCTTGATCTTGATCTTGATACTGACAGTACTATAGCAGGT

TCGGGGTTAGACTCCATTCTCAG AATCAATTCCCTTCCAACTTGTAAGTCCATTTTGCTCTTGTCTGGGGAACGCGGCTGTGGGAAGTCCACACTGATT

GCCAACTGGGTCAGTAATTTCCAAAGCAAACACCCCGGAGTGCTGATGATCCCATACTTTGTGGGCAGTACGTGTGAGAGCTGTGACATCATGTCTGTGA

TCCACTACTTCGTCATGGAGCTTCAGCACAGAGCCAACG GTCCCCGGCTTGAAATGGATTTCCTTAACGAGGACTCAAATGTCTTGGTCTTTTCACTTC

TCGTAGAAGTGTTCATAGCCGCCATAAGCTTAAAGCCATGCATCCTGGTACTAGACGGGATCGAAGAGCTGATCGGTATCTATGGGATTTCAGGTCAGAA

G GCGAAAGATTTCTCCTGGCTGCCGCGCTCCCTGCCTCCTCACTGTAAATTCATTCTGAGCAGCGTCTCCTCCAGTCTGTCCTGCAAGTCGCTGTGTGC

CCGCCCTGACGTGAAGATCGTGGAACTCAACAGCATCGGGGACGAAGACACCAAGTTCAACATCTTCAGACAGCACCTCTCCCCTGCCGACCAAGAACGC

TTCGGGCAGAGCAAGCCCATTTTGAGGAAGAAACCAAACCTGAGCCCTCTGAAGCTCGCAATCATCGCCAGCGAGCTGCAGGAGTGCAAAATCTACCGCA

ATGAGTTCCAGTGTCTCCGGGAGTACTTGGAGGTTGCCTCTGTGCAGGAGCTCTGGGAGTTGATTCTGAAGCGCTGGGTTGAAGATTATAGTTGGACTTT

GAAGCCTAAAGACACAACTCTAGACACCGTGATTCCAG GGCCAAGTGGCTGGGTAGTGGATGTGCTGTGCTTGCTCTGCATCTCTCACTGCGGGCTGGC

TGAGGATGAACTGCTCCAGCTTTTGGACACGATGGGCTACAGGGACCACCACAAAGTGACGGCGGTGCACTGGGCAGCCTTCCGCCAAGCCACCAAAACC

TGGATCCAGGAGAAGCCCAATGGTCTCCTCTACTTCCAGCACCAGTCCCTAAGGAGTGCCGTGGAGCACAAGCTGCTGG GTGTAAGCACTCCGGTGAGA

GAGAGCAATCCCAATGTGGCCCAGAACAGCGTGAATCACAAGAAGGCACATTTCCACCAGGTCTTGATGAGGTTCTTCCAGCGGCAAACCATCTTCTGGA

GGGTGTATCAGGAGCTGCCCTGGCACATGAAGATGAGCGGGTATTGGGAAGGTCTATGTAACTTCATCACGAACCCCAG CATCACAGATTTCATATCGA

AAATCCAAAACCCAAGCTTGTGGACCAGGCTGCACCTTGTCCACTACTGGGATGTGCTGCTGGAAGCCGGCAATGACGTGTCTGAGGCTTTTCTGCTCTC

TGTTGCCAAGATAGAAGGGGAACAATTCCAGAAACTCAAGAAGCGAACCACACTCTCAG TGCTGGAATGCAGCCTGTCCGAGATTACTGCTGCTGATAA

AGGCAGAATTATCCTCTTTATTGGAAGTTTCCTGAAGCTAATGGGCAAGATCAATGAAGCTGAAAAGCTGTTCTTGAGCGCTGAGGACTTGTTACTACAG

 AGCCCATCCATGACAGAAATGCTGCTCAGAGCTCAGAATGCCATTGGGGAATTATATCTTGAGATTGGGATGACTCCGAAAGGACTCACATATTTTCAG

AAAGCTTGGTCAAATCTGCTGCGGTTTACACTCAGCGACCTAAAGATCAGCCAGGAATTGATGAAGCAGAAAG TTAAAGTGATGAATAACCTGGCAAAA

TCGGCGCCTGGGGAATTCTTAAAAGAAAACCACGTTCTGGAATATGCTACCGAAATCTCCAAGTACGTGACTGGTAATCCCCGTGATCATGCTACCATGA

AATATACTGAAGGTGTTCTCAT GTTGGCTTCCGGAAACGCAGCCCTGGCAAAACTCAAGTTTCAAGAGTGTTTAACTATCAGAAGATGGCTATTTGGCA

ATAAAAACATACTAGTTGGAGAAATTATGGAATTCTTAGCAGATTTACTATTTTTTCTACTAGGAGAAAATGAAAA ATCTCAAAAGAAGCAAGCAATTG

AATATTATAAACAAGTCATAAAAATCAAGGAGAAGGCAGATACGGTGGCCACCTGCAAGCTTGTGAGGAAGCATCTGAGTATAAGCCTCAGCGACACCTT

GTGTAAACTAG CAGGCCAGCTGTTGTCAGGTGACTTCTGCCATCATGCCACAATGGAGGCAGTCAGCTATTTGTATAGGTCACTTGATTTAAGGGCAGC

TCACCTGGGGCCTACCCACGCTTCCATTGAGGGAATACTACA CCTTTTAAGGGAAATCCAGAGGTCCCGGGGCAGGAGGTCTTGGCCTCAAAGCATGAA

CCATCTATTCCCTAACGGTTCTAGGAATGGCTTTTCATTATGGGAGAATGTGCCTAAATTAAACTTCCACAGCGCTCAGAGTTCTGACACGGTAAACACT

GCAATGTGTATGAATATACGTAGGTTTCAGAGAGTTAAAAGCACACAGCCTTCTCTGGTTTCAGATAAACCAAAATATGTTCCCGGCAAAGGAAAGAAGA

CCTTGGCTCCAATTCTGTGCAAGTCTGCTGAGGAAAAGTTCCAACGTCAGGCTTCAGACTCACAAATATGGAATAGTCCAAGAAGACAACCTGCCAGGAA

AAAGGCAGCCTGTCCCCTTAAGACGGTCTCGCTCATTGACAAGAACGGCTTGGTGAGACTCTCAAGGCAGAGTGTTTCTTCTGCTGAGCTGGACAGCAGA

AAGGGCCTGATCACTTCCATCTGCCGGCAACCCCTGCAGCTACCTCATAATGTGGACAATCCCTGGAAGTCCATATCGGAACTCGTGTCAGAAAAGTGGC

TCTTCCACACTCCTCAGTACTGCTTCACTCCTCAGAAGCCAGGCTTCCCAAGAAGATCTCAGATTGAATCAAAATTGCTGAAGACCTCAGATGACCCCAA

TAAGGAATAAAAATAATTTTGGGCTGTTTTG
Translation
 - UNI36838 - MSDEASETGQRYNGQPILKRQKPILPYICSTLDFQEERDFLAKSIFPRLNDICSSRGTYFKAVDLRWSAVKAHKSFTSNQFRQYSC

LQSQHLKLSLDYVNRCFPFFIGLLGQTYGDFLPDYTPFLLSQVKDFESLSKGEQNLYIAAKNGYPWVLKTPNCSLTEFEIIQAVFRKKSQFQFFYFRTSN

SLLRTFNEEEEEEEEKLSSAYLLNEQGKMKVGKLKAKIIGKGLPVRFYRDLEELGDMVWKDWSAVVEKLYPFTTIMGNID DYKHSFENLYHEEFVENCK

QVFVTSKESNRTFEILERFAIKDLDLDLDTDSTIAGSGLDSILR RINSLPTCKSILLLSGERGCGKSTLIANWVSNFQSKHPGVLMIPYFVGSTCESCD

IMSVIHYFVMELQHRANG GPRLEMDFLNEDSNVLVFSLLVEVFIAAISLKPCILVLDGIEELIGIYGISGQK AKDFSWLPRSLPPHCKFILSSVSSSL

SCKSLCARPDVKIVELNSIGDEDTKFNIFRQHLSPADQERFGQSKPILRKKPNLSPLKLAIIASELQECKIYRNEFQCLREYLEVASVQELWELILKRWV

EDYSWTLKPKDTTLDTVIPG GPSGWVVDVLCLLCISHCGLAEDELLQLLDTMGYRDHHKVTAVHWAAFRQATKTWIQEKPNGLLYFQHQSLRSAVEHKL

LG GVSTPVRESNPNVAQNSVNHKKAHFHQVLMRFFQRQTIFWRVYQELPWHMKMSGYWEGLCNFITNPS SITDFISKIQNPSLWTRLHLVHYWDVLLE

AGNDVSEAFLLSVAKIEGEQFQKLKKRTTLSV VLECSLSEITAADKGRIILFIGSFLKLMGKINEAEKLFLSAEDLLLQ SPSMTEMLLRAQNAIGELY

LEIGMTPKGLTYFQKAWSNLLRFTLSDLKISQELMKQKV VKVMNNLAKSAPGEFLKENHVLEYATEISKYVTGNPRDHATMKYTEGVLM MLASGNAAL

AKLKFQECLTIRRWLFGNKNILVGEIMEFLADLLFFLLGENEK KSQKKQAIEYYKQVIKIKEKADTVATCKLVRKHLSISLSDTLCKLA AGQLLSGDF

CHHATMEAVSYLYRSLDLRAAHLGPTHASIEGILH HLLREIQRSRGRRSWPQSMNHLFPNGSRNGFSLWENVPKLNFHSAQSSDTVNTAMCMNIRRFQR

VKSTQPSLVSDKPKYVPGKGKKTLAPILCKSAEEKFQRQASDSQIWNSPRRQPARKKAACPLKTVSLIDKNGLVRLSRQSVSSAELDSRKGLITSICRQP

LQLPHNVDNPWKSISELVSEKWLFHTPQYCFTPQKPGFPRRSQIESKLLKTSDDPNKE

For any suggestions or comments, please send an email to unitrap@crg.es