Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044952 (Kctd21)
Chromosomal location
Chr 7: 104480837 - 104498719 (+)
Description
potassium channel tetramerisation domain containing 21 Gene [Source:MGI (curated);Acc:Kctd21-001]
RefSeq_dna
NM_001039039 
RefSeq_peptide
NP_001034128.2 
UniGene
Mm.334029 
MGI
MGI:3643121 
Uniprot/SWISSPROT
Q3URF8 
Uniprot/SPTREMBL
B2RTJ2 
Human Ortholog
ENSG00000188997 (KCTD21)
Omim not available
UniTrap UNI24079
Vector Insertion
Chr 7: 104480882 - 104495802
Public Clones (ggtc) IST14251G7 (tigm) IST14635G8 (tigm)
Private Clones OST235598 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000054107
Sequence
GAAGCTGCGCTGGCTGGAGGGGAGGCTGCCGAGCGAGGGCAGGAG - UNI24079 - AACTATTTCCAGGCACCCAGCCTCCTACCATGTCTGACCCC

ATTACACTGAATGTTGGGGGGAAGCTCTACACAACCTCACTGGCAACCCTGACCAGCTTCCCCGACTCCATGCTGGGGGCCATGTTCAGTGGGAAGATGC

CCACCAAGAGGGACAGCCAGGGTAACTGCTTCATTGACCGTGATGGCAAAGTGTTCCGCTATATCCTCAACTTCCTGCGGACCTCTCACCTGGATCTGCC

AGAGGACTTCCAGGAGATGGGTCTGCTGCGCAGGGAAGCCGACTTCTACCAGGTACAGCCCCTGATCGAGGCCCTGCAGGAAAAAGAGGTAGAACTCTCC

AAGGCGGAGAAGAATGCCATGCTTAACATCACCCTGAAGCAGCGCGTGCAGACGGTCCACTTCACCGTGCGGGAGGCACCACAGATCTACAGCCTGTCGT

CTTCCAGCATGGAGGTGTTCAACGCCAACATCTTCAGCACGTCCTGCCTCTTCCTCAAACTCCTTGGCTCTAAGCTCTTCTACTGCTCCAATGGCAATCT

CTCCTCCATCACCAGCCACTTGCAGGACCCTAACCATCTGACTCTTGACTGGGTAGCCAATGTGGAAGGCCTTCCAGAGGAAGAGTACACCAAGCAGAAC

CTGAAAAGGCTGTGGGTGGTCCCTGCCAACAAGCAGATCAACAGCTTCCAGGTCTTTGTGGAGGAGGTGCTGAAGATCGCTCTGAGTGATGGGTTCTGCA

TTGACTCTTCCCACCCACACGCTCTGGACTTCATGAACAATAAGATCATTCGGTTAATCCGGTACAGGTAAAAAGATCCTGGTCACACTGGGGAAGGCGT

TCCCAAGCAGCTCATGTCAGCGAAGGCTCTGAGGAGAGTGTCTCGCCAGTGGCCCGAGGCGGGGACCTATACTAATCTGTATTAATTGCATAGCAGGACC

TGATTCCCCATAACAAAGTTCACCTTCTGGAATCAACATGTCCTCTGAACAGAACCACCTTTCTTGCCATTTTTGAAGTGGCGATGGATAGCTTTGTGAT

GACAAGTTCAAAGTCAGCTGAAACGTACAAGAAGAGCCCACAGGAGGTCTCTCTGGCTATGACAAAGAGCAGCAGTTTTCTTACGGTGGAATCACCTGCC

CCTAGTCAGTGCCCTGCTAACCCATCTCCAGAGAGAGCCTTGGCTGTTGAAGGGTAGGGAACAAGAGTCTCCTTTTAGTTTCCTAGGCAACAACATGTGC

AGCAAATCCAGTCACTCCTGTTCTTTGCCTTGAGGATGCGCCCAGGCACCAGGACACCTTTGCCCAAAGGCAACAGTATTTGGGTGTTTTAGAATGCAAT

ATGTTCCCAGAACCCTTTGTGGCTCCACTCAGGGAGAAAGTTGAGCCATGGCATGGCCTAGGGGCATGAGTGTCCAGGCTGAGGCAGGAGGGGTGCCCTT

CCTGAAGAGGCTGGTATAGAAGGATTCTTGGCTTCAGAGAGTGTTTGTTTCCCCTGCAAAGATGTGATGGTATCGAAGCCAAGAAGATGGAAGACACTTC

GTGATCCAGCTGTTGCCTGACTTCTGTAATCCCAGCCCTGTGGATTGCAGGCATCACTGACACCAGTCAGTTTAAACCAATAATACGTTATGAACTCTCA

GGGTTGGAAAATAATCTGATAGTTTCTTAGTTCTTCCCCCTCTAGGATACCCCAGTCCGTGGCAGGGAGCCCCTCTTCTTGAGTATCTCCAAGGGATCCC

TTATGCCGGCTTGCACACCCCCTGGTGACACAATGGTCACTATCCCCAAGGCAGTTTCTGCTATGGTTGAGCAGTGCTGGCTCATAGAAAGCTCTTTCAG

TATTGACCCCAAGTCCGTCCTGTGCTAGGTCTTGTTGTTAGACCTTCCTCAGTACATGGATACGTGTCCCTGCTTTGACTAGACACTGAAGATGTCACTA

CTCAGAACTGATTCCCCTTTGCAACTTGGCTTTATCAGAATCAGCTCCTTTCCATCTTTGTAAGCCAGACGTCTTTCTTACGGCTTCGCTTTGTTCTCAG

CCCCCCGGTTCATCAGCCTTCCCCACCAGCATGGCTCAGCTTGCTCCTAATTATTTCTGGCTAGAAGATCACTGACTGAGGGGCTCTAGGGTTTTGGGAA

ATGGTGTTCAGCAAGCAGTCCAGGGGTCCTCTATAATCCCAGGGCCCCTGAGTAACTGGCCAGCCCCAACACTTCTCTTAAGAGAGCAGTCTTCCTTGTC

GTACTGTCCAGTCCCAACACTTTTCCTGGGACACAGTAAGCACGGAAACTCCAGACACTACTCCCCGGCAGGCAAGGGGCCCTGTGGAGTGACTACAGCA

GTGAGAGTCTTATAGCCCCCACCCGAGAAGCGCTCCACACACAGCTAGGGAAGCCTGGAGCCCGCATCCACAGGTGGACAGAGCAAAGGGCTTCCAGAGT

TACACTCTGTGAGTGAGAGGTTACAAAGTTAGAGGCAAAACTTGGTCCTGAGGCAATAAAGGCCTTTCTCTCCCTATAGTGGGACTCAGGAGTCTCTGTG

TGGCTGTCTTGAGCCGCTGCACCAGGGGTACTCTGGAAAGTTCTGCAGAGAACCCAATCAGGACAAGCAGATCTGTGGTCATATTCAAGTAAGTCAAAGA

AGAAATCTCAAATCAACACTGTCCCCCTCCCCCGAGTAAAACTTTGCTTTCGCCATCTTTTTGGTGCTTCCTAACTCAATACCCTGACCCTAGGGCAAGT

ACAGAGCCTGTTAAGCCACTAACATACTATGTGACTATACAAGTCACTCGCCTCACTGAGCCACCTCCATTTCTTCATCTGTGAAATGGGCATACAGTAA

TACATAACCCTACCTACCTCACAGGACCGTTGTGAGGATCAAACAAAATAATGTATGTGAGAATAAATGATAAATG
Translation
 - UNI24079 - MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDSQGNCFIDRDGKVFRYILNFLRTSHLDLPEDFQEMGLLRREADF

YQVQPLIEALQEKEVELSKAEKNAMLNITLKQRVQTVHFTVREAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTL

DWVANVEGLPEEEYTKQNLKRLWVVPANKQINSFQVFVEEVLKIALSDGFCIDSSHPHALDFMNNKIIRLIRYR

For any suggestions or comments, please send an email to unitrap@crg.es