Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000044968 (Napepld)
Chromosomal location
Chr 5: 21168719 - 21207212 (-)
Description
N-acyl phosphatidylethanolamine phospholipase D Gene [Source:MGI Symbol;Acc:MGI:2140885]
RefSeq_dna
NM_178728 
RefSeq_peptide
NP_848843.1 
UniGene
Mm.153292 
MGI
MGI:2140885 
Uniprot/SWISSPROT
Q8BH82 
Uniprot/SPTREMBL
Q8BLU8 
Human Ortholog
ENSG00000161048 (NAPEPLD)
Omim not available
UniTrap UNI21111
Vector Insertion
Chr 5: 21189284 - 21207022
Public Clones D161C09 (ggtc)
Private Clones OST340908 (lexicon) OST176304 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17011
Vector Insertion
Chr 5: 21176422 - 21181272
Public Clones (sanger)
Private Clones OST450938 (lexicon) OST429065 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17494
Vector Insertion
Chr 5: 21168718 - 21171181
Public Clones PSTVUpb18a12 (vanderbilt)
Private Clones OST441753 (lexicon) OST314903 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000057599
Sequence
ATGAGTATGAGGACAGCCAGTCTCCAGCGCCAA TATCAGTATCCAAAAGAAACACTGAGAAAGCGCCAGAATTCAGTGCAGAATTCAGGAGGAAGTGTG

TCTTCTAGGTTCTCCAGGAAAAGCTTCAAGCTGGATTACAGACTAGAGGAGGACGTAACTAAATCAAAGAAAGGAAAAGACGGGAGATTTGTTAACCCAT

GGCCAACATGGAAAAACATCTCCATCCCGAATGTGCTCAGATGGCTGATAATGGAGAAGAATCACAGCGGCGTTCCAGGTTCCAAAGAG GAACTTGACA

AAGAGCTCCCGGTGCTTAAGCCATATTTTGTCAGTGACCCTGAAGACGCTGGAGTGAGAGAGGCTGGCTTACGAGTCACGTGGCTGGGACATGCGACGCT

GATGGTGGAAATGGACGAGCTCATCTTCCTCACGGACCCCATGTTCAGCTCCCGTGCCTCTCCCTCGCAGTACATGGGTCCGAAGCGGTTTCGCCGCCCG

CCGTGTACAATAAGCGAACTCCCCACGATAGATGCTGTCCTCATCAGTCACAACCACTACGACCACCTAGACTACGGCTCGGTCCTGGCGTTGAACGAGC

GGTTCGGCAGCGAGCTGCGGTGGTTTGTGCCCTTGGGCCTTCTTGACTGGATGCAGAAATGTGGCTGCGAGAACGTGATTGAGCTGGACTGGTGGGAGGA

GAACTGCGTCCCTGGCCACGACAAGGTCACCTTCGTCTTCACGCCTTCCCAGCACTGGTGCAAAAGGACCCTCCTGGACGACAACAAGGTTCTCTGGGGC

AGCTGGTCCGTGCTAGGGCCTTGGAGTCGATTCTTCTTTGCTGGGGATACTGGCTACTGCCCCGCTTTTGAAGAGATTGGAAAAAGGTTTGGTCCTTTTG

ACCTTGCGGCCATTCCCATCGGAGCTTATGAACCAAG - UNI17011 - GTGGTTTATGAAATACCAGCATGCAGACCCAGAAGATGCTGTAAGGATT

CACATTGACCTTCAAACAAAGAGATCTGTGGCGATTCACTGGGGGACGTTTGCCTTAGCTAATGAG - UNI17494 - CATTACCTAGAGCCGCCAGT

GAAACTGAATGAAGCTCTAGAGAGATACGGACTTTCTTGTGAGGATTTCTTCATACTGAAGCATGGAGAGTCGAGATACTTGAATACCGATGATAGAGCT

TTTGAAGAAACATGAAACTAGGAATTTTCAGTGACAACAAAAGACTAAGAAATTCACAAATATTATGACACTTTTCACATGGAAACAATTTCTGCAAGTG

TGTGTTTTGTTTTATATTATAACTTGCCAATTGATAAGACTAGCTTACATAAATTGTGGGAGTCTAGGGATGGGTTATTTAAGAAACTGTCCAAAATAGA

CTTTAAAAAACCATACCAATGATACAAACATTGCAAAATATTGTTTTTTATCAAAACATTATATTTTAGTGGCAGTAAAATTTCTGAGGTTGTGAAAAAC

TGACATTAAAGTTCCATTTCTTTTTCTATTCAGGGCTTTCTACAGAGAGTCATGCTTACCTTTCTAGATTACACACACACACACACACACACACACACAC

CACACACACACCACACACACACCCCTTTCTTATATTTATGTAATGATAAACTTGACCTCCACATGGTCATTAACTGCTGGTCGTGGTGATGCACACCTGC

AGTCCAGCACTCCAAAGAATAAGCAGACAGGTGACAAGTTCAAGGCCAGCTAGAGCTACAAGTGAGAGAAGAAAACATTAGCTTACGTGCCAAATGTTAA

GTGATTTTGTTAACCATAAGAACATAGTTGTTTGGGCTAAATTTATTTTTTTAAAATAGGTTTTTTTTATTGTGGTCAAATATACATCTCATAAAATGAT

CATTTTAACTATGGTGAAAAGAAGCTCTTTGGCATCAACTGTTTGCATAGGTGTGCGGCCATGAGCATCATGCACTTACATCTCTGAGAGGGCATCATCC

ACACAGCTGCATTTCCCAGGTTCAAGGCTGATGGGCAGAGAAGGCAAGAGTGGGTTTGGGACTTAGGGCAGACCCTGTCCAAACCCAGCTATAACTGAAG

CCTCTCCCACAGGAGAGGATGTATTCCTGAGTGGGAGGACTTCACGCACTGGGGCGGCTCTCACTTTCTACTTCCTCTGTACTCTCTCCTGCTCCCTGCC

CCAAGATGTCAGGTAGACAGATGTACTAGTGAGTTTTACATGACTTGGATGTGGTATATATTTTTATATTAAATGACCTATAAGCACAAGTGTACCTTTT

AGTAAGCCATTGTGAAATGCCAGTAGTTACTCTGTGGCTATCTGCTGCCCAGGCTTTGTCCCAGTACGCCTCTGCATTCACAGGTTTGTTCTGTACCTTA

AGGAAGTGAGCTGCGGGGTCTTAGTGAACGTACACTCTGCTTCTGCTTTCTAGACCAATGGGACAAAGCAGTGAGTTTTCTATATATATCAAATATTATA

TAGGGAGTACTCAATAATTTGATTCATTTGCATGGGTGATGCATGTCACCTTGGCCTCTCATTGGAATTTTGCCCATCCCATCATGGACTTGATTACCCC

AAAACAAGTAACTTTTATGTTCAGACCCAATATCACCATGTACAAGAGGACAATGTTAACCTACCTCCCGAGGCAGAGAATAATATTTTTAAAGCACTTT

AGAAATCTAAGGGAGAAAACTTATGGTATCACTCTGATGCAGACAGGCACAGTAGACAGCTGAAGAGCAATGCTCCCGTTGATGCATTGTTCCTGCCCAG

ATGCTGAACTGGGGGCTGACCACCTCACCCACTCACCTTGTGACTTTAGAGGGGAATAGCCAATATGAGCGACCATCAGAATGTAGTATTTTTATATAAA

AGGTTTCCACCACTCACAAGGAGAGATGTGTACTGTAACCCTGCGTGTACAGTGAATGTGGCTCAGAGGCACTAATGCACAAGATTCCATTTAAAGTCAG

CTTGAGGAAAACCGGGCAAGCGTCGGCTCTCCACTGCAAGCGGACATGAATCTGGACCGTAGGGCCACGGGTGCCAGCCTTGGGGCACACCGCTCCACCG

GGTACCGCTGCAGCCACTGTGTTACTGTAAGCCACACTGAAACTTCTCTTAAGCAGCTGATATAGCTTTAATATTTCTGCATGAACGGCCTTGGCATAGC

TTTTGTGCCCACATGGACATGGTCCAGGCTTCCCATGTGATTTGTGGTCTGGTCCTGGGATGAATTGGGATTGCCTCATGTTTTTTTCTTTTTCTCTTTC

TTTCAGGCTTCCTCATGGTTTTTCTTTGTTTCTGTTTACATGTAAGTTCCACTCGTGAAGTACACCAAATCTCTCTCACACAACCACCCTATTGAATGGT

TTTCACTTTATTTTTCTAATCTACATTTCAAAGGATGTATGCATAAAGTGAAAATAAATTTTG
Translation
MSMRTASLQRQ YQYPKETLRKRQNSVQNSGGSVSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWPTWKNISIPNVLRWLIMEKNHSGVPGSKE EL

DKELPVLKPYFVSDPEDAGVREAGLRVTWLGHATLMVEMDELIFLTDPMFSSRASPSQYMGPKRFRRPPCTISELPTIDAVLISHNHYDHLDYGSVLALN

ERFGSELRWFVPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLLDDNKVLWGSWSVLGPWSRFFFAGDTGYCPAFEEIGKRFGP

FDLAAIPIGAYEPR - UNI17011 - RWFMKYQHADPEDAVRIHIDLQTKRSVAIHWGTFALANE - UNI17494 - HYLEPPVKLNEALERYGLS

CEDFFILKHGESRYLNTDDRAFEET
Transcript ENSMUST00000115217
Sequence
ACAGCGCGCCGCCTTCCCGGGAACCTGAGCGCCTGCGGGTGAGCCTCCCTGCTGTTAGCCTGGATCTTCGCGGGAGGCGGTTCGGCGACCGCGGTTCCTT

TTCGTTGGTTTGCTCCTTAGTCTCGATATCTGCGTGGAACAGCCTTTCTGGGGCTGTTCGGATACCTCGGTGAAGTGCAGCGGGTTTCGAGTAGGTTTCT

AGCACCCAAGCCCTGCCTCCTCCTGGAGATGCACTTGTGAGTGGCAGGCTTCTTTTGAATTACCGCACCTCTGGAGTTGCGGAGCTTGCATCTCTGGATC

CGCTTACGTGAAGAGCCACCGCGTTTTTAGGCGCCCAGAGGGAAGTAGCTGTATTTGGGATTTAAGATCTACCCTTCCTGCTGCAGACTCCCTGGTTACA

GCTCCACGATAGGAATACAA - UNI21111 - CTTCTCGCCGAGGGACATGGATGAGTATGAGGACAGCCAGTCTCCAGCGCCAAGCTATCAGTATCC

AAAAGAAACACTGAGAAAGCGCCAGAATTCAGTGCAGAATTCAGGAGGAAGTGTGTCTTCTAGGTTCTCCAGGAAAAGCTTCAAGCTGGATTACAGACTA

GAGGAGGACGTAACTAAATCAAAGAAAGGAAAAGACGGGAGATTTGTTAACCCATGGCCAACATGGAAAAACATCTCCATCCCGAATGTGCTCAGATGGC

TGATAATGGAGAAGAATCACAGCGGCGTTCCAGGTTCCAAAGAG GAACTTGACAAAGAGCTCCCGGTGCTTAAGCCATATTTTGTCAGTGACCCTGAAG

ACGCTGGAGTGAGAGAGGCTGGCTTACGAGTCACGTGGCTGGGACATGCGACGCTGATGGTGGAAATGGACGAGCTCATCTTCCTCACGGACCCCATGTT

CAGCTCCCGTGCCTCTCCCTCGCAGTACATGGGTCCGAAGCGGTTTCGCCGCCCGCCGTGTACAATAAGCGAACTCCCCACGATAGATGCTGTCCTCATC

AGTCACAACCACTACGACCACCTAGACTACGGCTCGGTCCTGGCGTTGAACGAGCGGTTCGGCAGCGAGCTGCGGTGGTTTGTGCCCTTGGGCCTTCTTG

ACTGGATGCAGAAATGTGGCTGCGAGAACGTGATTGAGCTGGACTGGTGGGAGGAGAACTGCGTCCCTGGCCACGACAAGGTCACCTTCGTCTTCACGCC

TTCCCAGCACTGGTGCAAAAGGACCCTCCTGGACGACAACAAGGTTCTCTGGGGCAGCTGGTCCGTGCTAGGGCCTTGGAGTCGATTCTTCTTTGCTGGG

GATACTGGCTACTGCCCCGCTTTTGAAGAGATTGGAAAAAGGTTTGGTCCTTTTGACCTTGCGGCCATTCCCATCGGAGCTTATGAACCAAG - UNI17

011 - GTGGTTTATGAAATACCAGCATGCAGACCCAGAAGATGCTGTAAGGATTCACATTGACCTTCAAACAAAGAGATCTGTGGCGATTCACTGGGGG

ACGTTTGCCTTAGCTAATGAG - UNI17494 - CATTACCTAGAGCCGCCAGTGAAACTGAATGAAGCTCTAGAGAGATACGGACTTTCTTGTGAGGA

TTTCTTCATACTGAAGCATGGAGAGTCGAGATACTTGAATACCGATGATAGAGCTTTTGAAGAAACATGAAACTAGGAATTTTCAGTGACAACAAAAGAC

TAAGAAATTCACAAATATTATGACACTTTTCACATGGAAACAATTTCTGCAAGTGTGTGTTTTGTTTTATATTATAACTTGCCAATTGATAAGACTAGCT

TACATAAATTGTGGGAGTCTAGGGATGGGTTATTTAAGAAACTGTCCAAAATAGACTTTAAAAAACCATACCAATGATACAAACATTGCAAAATATTGTT

TTTTATCAAAACATTATATTTTAGTGGCAGTAAAATTTCTGAGGTTGTGAAAAACTGACATTAAAGTTCCATTTCTTTTTCTATTCAGGGCTTTCTACAG

AGAGTCATGCTTACCTTTCTAGATTACACACACACACACACACACACACACACACCACACACACACCACACACACACCCCTTTCTTATATTTATGTAATG

ATAAACTTGACCTCCACATGGTCATTAACTGCTGGTCGTGGTGATGCACACCTGCAGTCCAGCACTCCAAAGAATAAGCAGACAGGTGACAAGTTCAAGG

CCAGCTAGAGCTACAAGTGAGAGAAGAAAACATTAGCTTACGTGCCAAATGTTAAGTGATTTTGTTAACCATAAGAACATAGTTGTTTGGGCTAAATTTA

TTTTTTTAAAATAGGTTTTTTTTATTGTGGTCAAATATACATCTCATAAAATGATCATTTTAACTATGGTGAAAAGAAGCTCTTTGGCATCAACTGTTTG

CATAGGTGTGCGGCCATGAGCATCATGCACTTACATCTCTGAGAGGGCATCATCCACACAGCTGCATTTCCCAGGTTCAAGGCTGATGGGCAGAGAAGGC

AAGAGTGGGTTTGGGACTTAGGGCAGACCCTGTCCAAACCCAGCTATAACTGAAGCCTCTCCCACAGGAGAGGATGTATTCCTGAGTGGGAGGACTTCAC

GCACTGGGGCGGCTCTCACTTTCTACTTCCTCTGTACTCTCTCCTGCTCCCTGCCCCAAGATGTCAGGTAGACAGATGTACTAGTGAGTTTTACATGACT

TGGATGTGGTATATATTTTTATATTAAATGACCTATAAGCACAAGTGTACCTTTTAGTAAGCCATTGTGAAATGCCAGTAGTTACTCTGTGGCTATCTGC

TGCCCAGGCTTTGTCCCAGTACGCCTCTGCATTCACAGGTTTGTTCTGTACCTTAAGGAAGTGAGCTGCGGGGTCTTAGTGAACGTACACTCTGCTTCTG

CTTTCTAGACCAATGGGACAAAGCAGTGAGTTTTCTATATATATCAAATATTATATAGGGAGTACTCAATAATTTGATTCATTTGCATGGGTGATGCATG

TCACCTTGGCCTCTCATTGGAATTTTGCCCATCCCATCATGGACTTGATTACCCCAAAACAAGTAACTTTTATGTTCAGACCCAATATCACCATGTACAA

GAGGACAATGTTAACCTACCTCCCGAGGCAGAGAATAATATTTTTAAAGCACTTTAGAAATCTAAGGGAGAAAACTTATGGTATCACTCTGATGCAGACA

GGCACAGTAGACAGCTGAAGAGCAATGCTCCCGTTGATGCATTGTTCCTGCCCAGATGCTGAACTGGGGGCTGACCACCTCACCCACTCACCTTGTGACT

TTAGAGGGGAATAGCCAATATGAGCGACCATCAGAATGTAGTATTTTTATATAAAAGGTTTCCACCACTCACAAGGAGAGATGTGTACTGTAACCCTGCG

TGTACAGTGAATGTGGCTCAGAGGCACTAATGCACAAGATTCCATTTAAAGTCAGCTTGAGGAAAACCGGGCAAGCGTCGGCTCTCCACTGCAAGCGGAC

ATGAATCTGGACCGTAGGGCCACGGGTGCCAGCCTTGGGGCACACCGCTCCACCGGGTACCGCTGCAGCCACTGTGTTACTGTAAGCCACACTGAAACTT

CTCTTAAGCAGCTGATATAGCTTTAATATTTCTGCATGAACGGCCTTGGCATAGCTTTTGTGCCCACATGGACATGGTCCAGGCTTCCCATGTGATTTGT

GGTCTGGTCCTGGGATGAATTGGGATTGCCTCATGTTTTTTTCTTTTTCTCTTTCTTTCAGGCTTCCTCATGGTTTTTCTTTGTTTCTGTTTACATGTAA

GTTCCACTCGTGAAGTACACCAAATCTCTCTCACACAACCACCCTATTGAATGGTTTTCACTTTATTTTTCTAATCTACATTTCAAAGGATGTATGCATA

AAGTGAAAATAAATTTTGAAAAAAAGTCTACTCTTGTTAGTCTAATATACATTGTAAAAATGTCTATCTTCTAAATAAAGTAAATATTATAAAAGTA
Translation
 - UNI21111 - MDEYEDSQSPAPSYQYPKETLRKRQNSVQNSGGSVSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWPTWKNISIPNVLRWLIM

EKNHSGVPGSKE ELDKELPVLKPYFVSDPEDAGVREAGLRVTWLGHATLMVEMDELIFLTDPMFSSRASPSQYMGPKRFRRPPCTISELPTIDAVLISH

NHYDHLDYGSVLALNERFGSELRWFVPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLLDDNKVLWGSWSVLGPWSRFFFAGDT

GYCPAFEEIGKRFGPFDLAAIPIGAYEPR - UNI17011 - RWFMKYQHADPEDAVRIHIDLQTKRSVAIHWGTFALANE - UNI17494 - HYLE

PPVKLNEALERYGLSCEDFFILKHGESRYLNTDDRAFEET
Transcript ENSMUST00000060899
Sequence
AGCGCCTGCGGGTGAGCCTCCCTGCTGTTAGCCTGGATCTTCGCGGGAGGCGGTTCGGCGACCGCGGTTCCTTTTCGTTGGTTTGCTCCTTAGTCTCGAT

ATCTGCGTGGAACAGCCTTTCTGGGGCTGTTCGGATACCTCGGTGAAGTGCAGCGGGTTTCGA - UNI21111 - CTTCTCGCCGAGGGACATGGATG

AGTATGAGGACAGCCAGTCTCCAGCGCCAAGCTATCAGTATCCAAAAGAAACACTGAGAAAGCGCCAGAATTCAGTGCAGAATTCAGGAGGAAGTGTGTC

TTCTAGGTTCTCCAGGAAAAGCTTCAAGCTGGATTACAGACTAGAGGAGGACGTAACTAAATCAAAGAAAGGAAAAGACGGGAGATTTGTTAACCCATGG

CCAACATGGAAAAACATCTCCATCCCGAATGTGCTCAGATGGCTGATAATGGAGAAGAATCACAGCGGCGTTCCAGGTTCCAAAGAG GAACTTGACAAA

GAGCTCCCGGTGCTTAAGCCATATTTTGTCAGTGACCCTGAAGACGCTGGAGTGAGAGAGGCTGGCTTACGAGTCACGTGGCTGGGACATGCGACGCTGA

TGGTGGAAATGGACGAGCTCATCTTCCTCACGGACCCCATGTTCAGCTCCCGTGCCTCTCCCTCGCAGTACATGGGTCCGAAGCGGTTTCGCCGCCCGCC

GTGTACAATAAGCGAACTCCCCACGATAGATGCTGTCCTCATCAGTCACAACCACTACGACCACCTAGACTACGGCTCGGTCCTGGCGTTGAACGAGCGG

TTCGGCAGCGAGCTGCGGTGGTTTGTGCCCTTGGGCCTTCTTGACTGGATGCAGAAATGTGGCTGCGAGAACGTGATTGAGCTGGACTGGTGGGAGGAGA

ACTGCGTCCCTGGCCACGACAAGGTCACCTTCGTCTTCACGCCTTCCCAGCACTGGTGCAAAAGGACCCTCCTGGACGACAACAAGGTTCTCTGGGGCAG

CTGGTCCGTGCTAGGGCCTTGGAGTCGATTCTTCTTTGCTGGGGATACTGGCTACTGCCCCGCTTTTGAAGAGATTGGAAAAAGGTTTGGTCCTTTTGAC

CTTGCGGCCATTCCCATCGGAGCTTATGAACCAAG - UNI17011 - GTGGTTTATGAAATACCAGCATGCAGACCCAGAAGATGCTGTAAGGATTCA

CATTGACCTTCAAACAAAGAGATCTGTGGCGATTCACTGGGGGACGTTTGCCTTAGCTAATGAG - UNI17494 - CATTACCTAGAGCCGCCAGTGA

AACTGAATGAAGCTCTAGAGAGATACGGACTTTCTTGTGAGGATTTCTTCATACTGAAGCATGGAGAGTCGAGATACTTGAATACCGATGATAGAGCTTT

TGAAGAAACATGAAACTAGGAATTTTCAGTGACAACAAAAGACTAAGAAATTCACAAATATTATGACACTTTTCACATGGAAACAATTTCTGCAAGTGTG

TGTTTTGTTTTATATTATAACTTGCCAATTGATAAGACTAGCTTACATAAATTGTGGGAGTCTAGGGATGGGTTATTTAAGAAACTGTCCAAAATAGACT

TTAAAAAACCATACCAATGATACAAACATTGCAAAATATTGTTTTTTATCAAAACATTATATTTTAGTGGCAGTAAAATTTCTGAGGTTGTGAAAAACTG

ACATTAAAGTTCCATTTCTTTTTCTATTCAGGGCTTTCTACAGAGAGTCATGCTTACCTTTCTAGATTACACACACACACACACACACACACACACACCA

CACACACACCACACACACACCCCTTTCTTATATTTATGTAATGATAAACTTGACCTCCACATGGTCATTAACTGCTGGTCGTGGTGATGCACACCTGCAG

TCCAGCACTCCAAAGAATAAGCAGACAGGTGACAAGTTCAAGGCCAGCTAGAGCTACAAGTGAGAGAAGAAAACATTAGCTTACGTGCCAAATGTTAAGT

GATTTTGTTAACCATAAGAACATAGTTGTTTGGGCTAAATTTATTTTTTTAAAATAGGTTTTTTTTATTGTGGTCAAATATACATCTCATAAAATGATCA

TTTTAACTATGGTGAAAAGAAGCTCTTTGGCATCAACTGTTTGCATAGGTGTGCGGCCATGAGCATCATGCACTTACATCTCTGAGAGGGCATCATCCAC

ACAGCTGCATTTCCCAGGTTCAAGGCTGATGGGCAGAGAAGGCAAGAGTGGGTTTGGGACTTAGGGCAGACCCTGTCCAAACCCAGCTATAACTGAAGCC

TCTCCCACAGGAGAGGATGTATTCCTGAGTGGGAGGACTTCACGCACTGGGGCGGCTCTCACTTTCTACTTCCTCTGTACTCTCTCCTGCTCCCTGCCCC

AAGATGTCAGGTAGACAGATGTACTAGTGAGTTTTACATGACTTGGATGTGGTATATATTTTTATATTAAATGACCTATAAGCACAAGTGTACCTTTTAG

TAAGCCATTGTGAAATGCCAGTAGTTACTCTGTGGCTATCTGCTGCCCAGGCTTTGTCCCAGTACGCCTCTGCATTCACAGGTTTGTTCTGTACCTTAAG

GAAGTGAGCTGCGGGGTCTTAGTGAACGTACACTCTGCTTCTGCTTTCTAGACCAATGGGACAAAGCAGTGAGTTTTCTATATATATCAAATATTATATA

GGGAGTACTCAATAATTTGATTCATTTGCATGGGTGATGCATGTCACCTTGGCCTCTCATTGGAATTTTGCCCATCCCATCATGGACTTGATTACCCCAA

AACAAGTAACTTTTATGTTCAGACCCAATATCACCATGTACAAGAGGACAATGTTAACCTACCTCCCGAGGCAGAGAATAATATTTTTAAAGCACTTTAG

AAATCTAAGGGAGAAAACTTATGGTATCACTCTGATGCAGACAGGCACAGTAGACAGCTGAAGAGCAATGCTCCCGTTGATGCATTGTTCCTGCCCAGAT

GCTGAACTGGGGGCTGACCACCTCACCCACTCACCTTGTGACTTTAGAGGGGAATAGCCAATATGAGCGACCATCAGAATGTAGTATTTTTATATAAAAG

GTTTCCACCACTCACAAGGAGAGATGTGTACTGTAACCCTGCGTGTACAGTGAATGTGGCTCAGAGGCACTAATGCACAAGATTCCATTTAAAGTCAGCT

TGAGGAAAACCGGGCAAGCGTCGGCTCTCCACTGCAAGCGGACATGAATCTGGACCGTAGGGCCACGGGTGCCAGCCTTGGGGCACACCGCTCCACCGGG

TACCGCTGCAGCCACTGTGTTACTGTAAGCCACACTGAAACTTCTCTTAAGCAGCTGATATAGCTTTAATATTTCTGCATGAACGGCCTTGGCATAGCTT

TTGTGCCCACATGGACATGGTCCAGGCTTCCCATGTGATTTGTGGTCTGGTCCTGGGATGAATTGGGATTGCCTCATGTTTTTTTCTTTTTCTCTTTCTT

TCAGGCTTCCTCATGGTTTTTCTTTGTTTCTGTTTACATGTAAGTTCCACTCGTGAAGTACACCAAATCTCTCTCACACAACCACCCTATTGAATGGTTT

TCACTTTATTTTTCTAATCTACATTTCAAAGGATGTATGCATAAAGTGAAAATAAATTTTG
Translation
 - UNI21111 - MDEYEDSQSPAPSYQYPKETLRKRQNSVQNSGGSVSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWPTWKNISIPNVLRWLIM

EKNHSGVPGSKE ELDKELPVLKPYFVSDPEDAGVREAGLRVTWLGHATLMVEMDELIFLTDPMFSSRASPSQYMGPKRFRRPPCTISELPTIDAVLISH

NHYDHLDYGSVLALNERFGSELRWFVPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLLDDNKVLWGSWSVLGPWSRFFFAGDT

GYCPAFEEIGKRFGPFDLAAIPIGAYEPR - UNI17011 - RWFMKYQHADPEDAVRIHIDLQTKRSVAIHWGTFALANE - UNI17494 - HYLE

PPVKLNEALERYGLSCEDFFILKHGESRYLNTDDRAFEET

For any suggestions or comments, please send an email to unitrap@crg.es