Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000045071 (E130308A19Rik)
Chromosomal location
Chr 4: 59639083 - 59767175 (+)
Description
RIKEN cDNA E130308A19 gene Gene [Source:MGI Symbol;Acc:MGI:2442164]
RefSeq_dna
NM_153158 NM_001015681 
RefSeq_peptide
NP_694798.1 NP_001015681.1 
UniGene
Mm.45688 
MGI
MGI:2442164 
Uniprot/SWISSPROT
Q8C4P0 
Uniprot/SPTREMBL
B1AX79 Q0P6E2 Q80WW0 
Human Ortholog
ENSG00000165185 (KIAA1958)
Omim not available
UniTrap UNI906
Vector Insertion
Chr 4: 59639198 - 59639364
Public Clones BC0443 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24121
Vector Insertion
Chr 4: 59639364 - 59703015
Public Clones IST14673A3 (tigm) IST14633G10 (tigm)
Private Clones OST234007 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000052420
Sequence
GCTCCAAGCCGGGCGCGCGGAGCCCGGGGCGCACGGAGCGGCGCGCGCCGGTGGCCGAGCCAGGCTGGCGCCTGCGCCCCCCCCTCTCATCGCACCACCG

CCGTCACCCGCCGCGCAGCCCGTGGGGCGCCCTTCCCGGTTCACCGACTCCGGCCCCGGGGCCTCCGGCTGTGGTGCTGCCGCCCTCCGTCCCGCCGTCC

CTCCCCGTCCAGCTCGGGCCGCCGGGCTCCCGCAGGCCCCACCGCCCGCGTTCCTATGGACAGACGCACAGACACCTGCAG - UNI906 - - UNI24

121 - GAGAGACACTGCTGATCCTGTAACATGGAGGATTGTCTTCATACCTCATCTGAGAATCTGTCCAAATTGGTCAGCTGGGCCCACAGCCATGGGA

CCATTTGCAGCCTCATTCCAAACCTGAAACACTTGCTTTCTGAAGGTTCCCATGGGAACCTGACTGCAATGTGGGGCTGTAGTGCCGGCCATGCGTACCA

CTGGCCACTAACAGCTACTTGCAGAGCTGGGTCCCAAGAGAGGGTTTGTTTCCAGGACAACCGAAGTTTTAATTCTGATAGTCCCAGTATAATTGGGGTG

CCTTCTGAGACACAGACTAGCCCTGTGGAAAGGTACCCTGGGAGACCTGTGAAGGCAAAGCTGGACTGTAATCGGACCAGAGACTCTTGTGACTTCTCTT

ACTGCAGTGAGCCCTCTGAACTGGATGAAGCTGTCGAGGAGTATGAAGATGAAAACACACTGTTTGACATGGTTTGCGAGTCTTCTGTTACAGATGAGGA

CAGTGACTTTGAACCCCAAACCCAGAGACCTCAAAGCATTGCTCGCAAAAGGCCAGGAATCGTCCCATCTTCCATCCATTCAAGTTCCCAGGGACAGATG

GTCGATGAATGCAGTAATGATGTCATCATCAAGAAAATCAAGCAAGAGATTCCAGAAGATTATTACATTGTGGCAAATGCAGAGCTGACTGGAGGAGTGG

ATGGACCAGCCCTTTCATTGACACAGATGGCAAAACCCAAACCCCAGACTCATGCTGGTCCCTCCTGTGTAGGGTCTGCTAAACTGATTCCCCATGTAAC

ATCTGCCATCAACACGGAATTAGACCCACACATTCTGTCAGCCTCTCCCTCTGTTATCTCCAGACCGATCATCCCAAAGACTGCTAGGGTATCTCTGGCT

TCACCAAACAGAGGACCCCCTGGTGCCCATGGCACTGCCCACCAGGTGACCATGCAGATGCCTGTGAGCACATCACATCCTAACAAACAGATCAGTATCC

CTTTGTCTGCTCTGCAGTTGCCTGGACAGGATGAGCAAGTTGCTTCGGAGGAGTTCCTGCCCCACTTGCCTAGCCAGGTCTCATCATGTGAGGTAGCCCT

TTCTCCCTCTGTTAACACAGAGCCTGAAGTGAGCTCCAGTCAACAGCAGCCCCCTGCTGCTCCAACCATAACCACTGAAGCCACCGCGCAGTGCATTCCA

G ACCAGGATGAAAGAGCAGCTGAGCTCAGCAGGGAGCAGAACGAGAAAACCATCCGGAGCACGCAGACCGCGCTCCGCAATTTCCGCGAGTTCCTCATC

TCCAAGTACCCTTCCGAGACCAGAGAGATCTATGTCATCCCTTGCAAGGAGCTAGATGCCTACCTTGCCTCCTTCTTCGTGGATGCCAGGCAGAAGGATG

GGTCTGAGTACGAGCCCAACAGCTTGGCCAATTACCAGTGTGGGCTGGAACGGTACCTGAAAGAGCACAGATATGGCTACAGCATCACCAGGGATAAGGA

GTTCAAGCGTTCCCAGGAAGCCCTGAAACAGAAACAGATCGAGCTTCGCTGCAAAGGCAAGGGGAACAAGCCACACAAGTCCATGAAGCTCACCTTTGCC

GATGAGCTCATCCTGCGGAAGAGGGGACTGCTGAGCAGGTACAACCCTGAGGGTCTGCTCAACCTCGTCTGGCTCAACAACACGAAAGCGTTTGGCCACT

GCACAGGCTTCCATGGATCCACCTTGAAATGGGGCGATATCCGGCTCCGTGTCACAGAAACCGGGCTTGAGTATTTGGAGTGGATAGGTCAGGACACTGG

TGATTTGAATGCCAAAACCAAGAGAGGAGGAACGGACTCGCGAGTTTATGCCACCCAGCATGCCCCGCAGACCTGCCCGGTGCAGGATTATAAGGAGTAT

GCCCAGCGGAGGCCTCCTGCTATGCGCTATGAGGATGCCCCCTTCTACTTGTCCATCAAGCCAGTTGTGAACTTGGCAGCTCTTCACTGGTACAATTGCC

AGGCCCTTGGCAAGAACAAGCTAGCCAAGATGGTGAAGACCATGTGTGAGAAGGGCAACATCCCCGGCAGGAAGACCAACTTCAGTGTCTACCAGAGCTG

TAGCACCTTGTCTGAGGCCCAGAGCAATCAGCTGGTGCTCATCTGCAACAACCTGAGCCAGCAGGCTGCCCAGTCCGTGGCTGGCCACTCCAGCAGTGGC

AATTTCATTGTCTCCTCCTATGACTCTTCCTCGGACACGGCCTGA
Translation
 - UNI906 - - UNI24121 - MEDCLHTSSENLSKLVSWAHSHGTICSLIPNLKHLLSEGSHGNLTAMWGCSAGHAYHWPLTATCRAGSQERVCFQ

DNRSFNSDSPSIIGVPSETQTSPVERYPGRPVKAKLDCNRTRDSCDFSYCSEPSELDEAVEEYEDENTLFDMVCESSVTDEDSDFEPQTQRPQSIARKRP

GIVPSSIHSSSQGQMVDECSNDVIIKKIKQEIPEDYYIVANAELTGGVDGPALSLTQMAKPKPQTHAGPSCVGSAKLIPHVTSAINTELDPHILSASPSV

ISRPIIPKTARVSLASPNRGPPGAHGTAHQVTMQMPVSTSHPNKQISIPLSALQLPGQDEQVASEEFLPHLPSQVSSCEVALSPSVNTEPEVSSSQQQPP

AAPTITTEATAQCIPD DQDERAAELSREQNEKTIRSTQTALRNFREFLISKYPSETREIYVIPCKELDAYLASFFVDARQKDGSEYEPNSLANYQCGLE

RYLKEHRYGYSITRDKEFKRSQEALKQKQIELRCKGKGNKPHKSMKLTFADELILRKRGLLSRYNPEGLLNLVWLNNTKAFGHCTGFHGSTLKWGDIRLR

VTETGLEYLEWIGQDTGDLNAKTKRGGTDSRVYATQHAPQTCPVQDYKEYAQRRPPAMRYEDAPFYLSIKPVVNLAALHWYNCQALGKNKLAKMVKTMCE

KGNIPGRKTNFSVYQSCSTLSEAQSNQLVLICNNLSQQAAQSVAGHSSSGNFIVSSYDSSSDTA
Transcript ENSMUST00000070150
Sequence
AGCCCGTGGGGCGCCCTTCCCGGTTCACCGACTCCGGCCCCGGGGCCTCCGGCTGTGGTGCTGCCGCCCTCCGTCCCGCCGTCCCTCCCCGTCCAGCTCG

GGCCGCCGGGCTCCCGCAGGCCCCACCGCCCGCGTTCCTATGGACAGACGCACAGACACCTGCAG - UNI906 - - UNI24121 - GAGAGACACT

GCTGATCCTGTAACATGGAGGATTGTCTTCATACCTCATCTGAGAATCTGTCCAAATTGGTCAGCTGGGCCCACAGCCATGGGACCATTTGCAGCCTCAT

TCCAAACCTGAAACACTTGCTTTCTGAAGGTTCCCATGGGAACCTGACTGCAATGTGGGGCTGTAGTGCCGGCCATGCGTACCACTGGCCACTAACAGCT

ACTTGCAGAGCTGGGTCCCAAGAGAGGGTTTGTTTCCAGGACAACCGAAGTTTTAATTCTGATAGTCCCAGTATAATTGGGGTGCCTTCTGAGACACAGA

CTAGCCCTGTGGAAAGGTACCCTGGGAGACCTGTGAAGGCAAAGCTGGACTGTAATCGGACCAGAGACTCTTGTGACTTCTCTTACTGCAGTGAGCCCTC

TGAACTGGATGAAGCTGTCGAGGAGTATGAAGATGAAAACACACTGTTTGACATGGTTTGCGAGTCTTCTGTTACAGATGAGGACAGTGACTTTGAACCC

CAAACCCAGAGACCTCAAAGCATTGCTCGCAAAAGGCCAGGAATCGTCCCATCTTCCATCCATTCAAGTTCCCAGGGACAGATGGTCGATGAATGCAGTA

ATGATGTCATCATCAAGAAAATCAAGCAAGAGATTCCAGAAGATTATTACATTGTGGCAAATGCAGAGCTGACTGGAGGAGTGGATGGACCAGCCCTTTC

ATTGACACAGATGGCAAAACCCAAACCCCAGACTCATGCTGGTCCCTCCTGTGTAGGGTCTGCTAAACTGATTCCCCATGTAACATCTGCCATCAACACG

GAATTAGACCCACACATTCTGTCAGCCTCTCCCTCTGTTATCTCCAGACCGATCATCCCAAAGACTGCTAGGGTATCTCTGGCTTCACCAAACAGAGGAC

CCCCTGGTGCCCATGGCACTGCCCACCAGGTGACCATGCAGATGCCTGTGAGCACATCACATCCTAACAAACAGATCAGTATCCCTTTGTCTGCTCTGCA

GTTGCCTGGACAGGATGAGCAAGTTGCTTCGGAGGAGTTCCTGCCCCACTTGCCTAGCCAGGTCTCATCATGTGAGGTAGCCCTTTCTCCCTCTGTTAAC

ACAGAGCCTGAAGTGAGCTCCAGTCAACAGCAGCCCCCTGCTGCTCCAACCATAACCACTGAAGCCACCGCGCAGTGCATTCCAG CTTATTCTACTAAG

CTCAACAAATTTCCTGTATTTAATATTAATGATGACTTGAATGGTCTGTGTACCAGTGCAGTGAGCCCAAACACCACCAAAGCCACGAGGTACGCCCTAA

ATGTGTGGCGCTACTGGTGCATGACCAACGGGCTCAAAGACCACACGGACATCACCAAG ATCCCTGCAGTGAAACTGAATGAGCTGCTTGAGAACTTTT

ATGTCACCGTCAAGAAGAGTGACGGCTCAGACTTCCTGGCTACCTCGCTTCATGCCATTCGCCGAGGCCTGGACCGCATCCTGAAGAACGCGGGTGTGGG

CTTTTCCATCACCAGCAGCACCTTCAGCTCCTCCACCAAGAAACTCAAGGAGAAGCTGTGGGTCCTGAGCAAGGCAGGGATGTCGGGGGCCCGTTCCCGC

AATATCGTCTACTTCTCCCTTTCTGATGAGGAGGAGATGTGGCAGGCAGGGTGTCTAGGGGATGACAGCCCAATTACTCTCCTGTCCACAGTGGTCAAGT

ACAACAGCCAGTATCTGAATATGCGGACTCTGCAGGAACATGCAGATCTGATGTATGGTGACATCGAGTTGCTCAAAGATCCGCAAAACCAGCCCTACTT

TGCCCGGACCGACAGTGTCAAGCGGGAGAGCCGGAGTGGTTCGACCAGAGTGTGCCATGGGAAAATCTACCATGAGCACTCCAGGGGACACAAGCAGTGT

CCTTACTGCCTCCTCTACAAGTACATGTACATCCACCGGCCACCCACCCAAATGGAGGCCAAGTCTCCCTTCTACCTTACAGCCCGGAAGGAGGCCACGG

ACATGGGCAGCGTGTGGTACGAAGAGCAGAGAATGGGGTTACGGTCTCTCCGGGGAATTGTCCCAAATTTAGCCAGGAAGGTCAAGCTGGAAAACTGTGA

GAACTTCACCTTCGTCTCCTTCACTCAGGTCTCCAGGCGACTTGGCTCCCATAGCTGCTGCCAGTGAGCCCCCAGGGCCAGCAGGTTCTGAAGCCGCAGA

GACTGATGTCCTCGCTCCGTGATCCAGCTGGTCTCCGTTACTACAGCCGGCCATTCCTCAGACTTGAGATTCACTTTTACATGAAAGTCGATGACTGAAT

AATTTGGATGTTTTATCTAAATGTTTGACACCTTGTTAAATCATAGAATATAACACAATATAAAATTACTATATACAAAAGTGAAGAAATTCATTTTATC

TAGTGCCTTTTTAGCACAGGTTTTCTTGGAAAAAAAGAAAAGAAAAAGAAAAAAAAATGTTTTGAGTAGTTACTTAAAAAATATCCCAGTAGCCCAGTAG

CTTTAGAATGGTATAGAATTATATATACTTTGTTGGTTTTCTGGGGTTTTTTGTTTTTCCCCACGTAGGGACCTAGAGCAGGAGAGGCAGACATAGTAGA

GAAAACTCTCACTCAGCACCCTTGTGTTTTGTTGGGGCCCTGGCAGTGGGCTGCTTGCAGAAATAAAAGATACATTGTTGCTACGCTGTCTGTCCATAGA

GGCAGTTTGGTGACAGGAAGATCAGTTCTCTGAAAGGGTGTACAGGAAACACGGTGTGCAGTGGACTCGGTGGTGTGCACTGTGAGGAGTTCTAGATAGC

GGAGGGTGGACTTGGAAAGCCCCCGCGGCCCAGATGTGAAACCCCCCCGAAGCAGAAGTGCCTGCGTCTGTCCAGTTCTCCTTAGAGAACACTTGCTGTT

TGAACTTCCTTTTGTTTGTTTTGTTGTTTAATCTGCATTGTTACATCTCGGATTTACATCTCACAGTTGTGTTGGCAGGAGTCCCTGGACCTGTGAGGCT

AGCAGCGATGCTTGACTAGGAGAATCAACAGAGAGAGTCACAAGGCAAACACTCCCAGGGCATCTTAAGGGCCCTGGGAATCCTGTAGGCTGGCACTATG

TTAGGGACACTGATTCAGGCAGCCTGCCAGGAAACCAAGCCCGGCACAGGGACATAGTTACTGGATCAGAGTGTCACGGTAGGTCATTCCTGCATTTAAA

AATCATTTCGCATTAATAAAAGTCAACCTGACCATGTGTTACTTAAAAAGCAGACTTTTCTAGCAACTACTGTGAATACGTGTTTTTAAAATGGAGCCCA

AAGAGTGCTAATTAATAGTAGTAATTTCTACTCTATTTTCTATTCCAGGAAAGACTGCTCTAATTGTACCATTATGTTCTTGTGTATGCTTTCTAATCCC

AAATTAAAGCCCCAATGCACATTCATATTGC
Translation
 - UNI906 - - UNI24121 - MEDCLHTSSENLSKLVSWAHSHGTICSLIPNLKHLLSEGSHGNLTAMWGCSAGHAYHWPLTATCRAGSQERVCFQ

DNRSFNSDSPSIIGVPSETQTSPVERYPGRPVKAKLDCNRTRDSCDFSYCSEPSELDEAVEEYEDENTLFDMVCESSVTDEDSDFEPQTQRPQSIARKRP

GIVPSSIHSSSQGQMVDECSNDVIIKKIKQEIPEDYYIVANAELTGGVDGPALSLTQMAKPKPQTHAGPSCVGSAKLIPHVTSAINTELDPHILSASPSV

ISRPIIPKTARVSLASPNRGPPGAHGTAHQVTMQMPVSTSHPNKQISIPLSALQLPGQDEQVASEEFLPHLPSQVSSCEVALSPSVNTEPEVSSSQQQPP

AAPTITTEATAQCIPA AYSTKLNKFPVFNINDDLNGLCTSAVSPNTTKATRYALNVWRYWCMTNGLKDHTDITK IPAVKLNELLENFYVTVKKSDGSD

FLATSLHAIRRGLDRILKNAGVGFSITSSTFSSSTKKLKEKLWVLSKAGMSGARSRNIVYFSLSDEEEMWQAGCLGDDSPITLLSTVVKYNSQYLNMRTL

QEHADLMYGDIELLKDPQNQPYFARTDSVKRESRSGSTRVCHGKIYHEHSRGHKQCPYCLLYKYMYIHRPPTQMEAKSPFYLTARKEATDMGSVWYEEQR

MGLRSLRGIVPNLARKVKLENCENFTFVSFTQVSRRLGSHSCCQ

For any suggestions or comments, please send an email to unitrap@crg.es