Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000045128 (Rpl18a)
Chromosomal location
Chr 8: 73419278 - 73421313 (-)
Description
ribosomal protein L18A Gene [Source:MGI Symbol;Acc:MGI:1924058]
RefSeq_dna
NM_029751 
RefSeq_peptide
NP_001104586.1 NP_084027.1 
UniGene
Mm.442877 Mm.475864 
MGI
MGI:1924058 
Uniprot/SWISSPROT
P62717 
Uniprot/SPTREMBL
Q3THJ0 
Human Ortholog
ENSG00000217644 (AL355864.7)
Omim not available
UniTrap UNI11562
Vector Insertion
Chr 8: 73420212 - 73421257
Public Clones (sanger) P068B06 (ggtc) IST11035G9 (tigm) IST14600C10 (tigm)
Private Clones OST10013 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000054220
Sequence
TTCCTTTTGTGACTGGCGGTGAACGAGTGCGCAGTGCCATGAAGGCCTCGGGCACG - UNI11562 - CTTCGGGAGTACAAGGTGGTGGGGCGCTGC

TTGCCAACCCCAAAATGCCACACACCACCACTGTACCGTATGCGAATCTTTGCACCCAACCATGTGGTGGCCAAGTCCCGCTTCTGGTACTTTGTGTCAC

AGCTGAAGAAGATGAAGAAGTCATCCGGGGAAATTGTGTACTGCGGACAG GTGTTTGAGAAGTCACCCCTGCGTGTGAAGAACTTTGGCATCTGGCTGC

GCTATGACTCCCGCAGTGGCACACACAACATGTATCGGGAGTACAGGGACCTGACCACTGCTGGTGCAGTCACACAGTGCT ACCGAGACATGGGTGCCC

GACACCGTGCCCGTGCCCACTCCATCCAGATCATGAAGGTGGAAGAGATTGCAGCTGGCAAGTGCCGCCGGCCAGCTGTCAAGCAGTTCCAC GACTCCA

AGATCAAATTCCCACTGCCCCACCGTGTGTTGCGGCGCCAGCACAAGCCACGCTTCACCACCAAGAGGCCCAACACCTTCTTCTAGACACAGAGACCCAC

TGAATAAAAACTTGAGACTGTC
Translation
MKASGT - UNI11562 - LREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQ VFEKSPLRVKNFGIWLRYD

SRSGTHNMYREYRDLTTAGAVTQCY YRDMGARHRARAHSIQIMKVEEIAAGKCRRPAVKQFH DSKIKFPLPHRVLRRQHKPRFTTKRPNTFF

For any suggestions or comments, please send an email to unitrap@crg.es