Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000045414 (1190002N15Rik)
Chromosomal location
Chr 9: 94418283 - 94438500 (-)
Description
RIKEN cDNA 1190002N15 gene Gene [Source:MGI Symbol;Acc:MGI:1916111]
RefSeq_dna
NM_001033145 
RefSeq_peptide
NP_001028317.2 
UniGene
Mm.258746 Mm.409951 Mm.474682 Mm.474700 
MGI
MGI:1916111 
Uniprot/SWISSPROT
Q3USZ8 
Uniprot/SPTREMBL
Q3TS89 
Human Ortholog
ENSG00000181744 (C3orf58)
Omim not available
UniTrap UNI19868
Vector Insertion
Chr 9: 94421066 - 94424810
Public Clones not available
Private Clones OST378428 (lexicon)
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000061904
Sequence
GGAGTCGGAGGGCGGGGAGCTCGGAGGAGGGCACCGGGAGTTGTGGAGACAGCCGATCGGGAAGTCGCCGCGCTCGGCCGGCGCAGCCCGTCCTCGGGTT

CCTTCGCTGCCGCCCTCCGTCTGCGCCGCGGGCCTCGGCGCCGTGGGGCGGCCCGGCGGGGTGCGCTCGCCCGCCCCGGCCCCGGCCGCTGCCGCGCGCG

GGCGGGATGTGGCGCCTGGTGCCCCTGAAGCTGGGCCGCCTGTCCCGTGCACTGAAGCTGGCGGCGCTCGGCAGCCTGTTGGTGCTGATGCTGCTGCACT

CGCCGTCGCTGCTCGCCTCCTGGCAGCGCAACGAGCTCGCCGACCGGCGCTTCCTGCAGCTCAATAAGTGCCCGGCGTGCTTCGGCACGAGCTGGTGCCG

CCGTTTCCTCAACGGCCAGGTGGGCTTCGAGACGTGGGGCCGCCTGCGCCTGCTGGACTTCCTCAACGTGAAGAACGTGTACTTCGCGCAGTACGGCGAG

CCCCGCGAGGGCGGCCGCCGGCGCGTGGTGCTCAAGCGCCTGGGTTCGCAGCGCGAGCTGGCGCAGCTCGACCAGAGCATCTGCAAGCGGGCCACCGGCC

GGCCGCGCTGCGACCTGCTCCAGGCCATGCCCCGCACCGAGTTCGCGCGTCTCAACGGCGACGTGCGGCTGCTCACGCCGGAGGCGGTGGAGGGTTGGTC

GGACCTGGTGCACTGCCCCTCGCAGCGCCTGCTGGACCGCCTGGTGCGCCGCTACGCGGAGACCAAGGACTCGGGCAGTTTCCTGCTGCGTAACCTCAAG

GACTCCGAGCGCATGCAGCTGCTGCTCACCCTGGCCTTCAACCCCGAGCCGCTGGTGCTACAG AGTTTTCCATCTGATGAAGGTTGGCCATTTGCAAAA

TATCTTGGAGCTTGTGGAAGAATGGTGGCTGTAAATTATGTTGGAGAAGAACTGTGGAGTTATTTTAATGCACCATGGGAGAAGAGAGTTGACCTTGCTT

GGCAGTTAATGGAGATAGCAGAGCAGCTTACAAACAATGACTTTGAATTTGCACTCTACCTCCTGGACGTCAGCTTTGACAACTTTGCAGTTGGTCCAAG

AGATGGGAAAGTAATCATTGTGGATGCCGAAAATGTTTTAGTTGCCGACAAAAGATTAATTAGACAAA - UNI19868 - ATAAGCCTGAGAATTGGG

ACGTATGGTATGAAAGCAAGTTTGACGATTGTGACAAGGAAGCTTGCTTGTCATTTTCAAAAGAAATCCTCTGTGCTCGTGTCACTGTGGACCACAATTA

CTATGCCGTTTGTCAGAACCTCTTATCCAGACATGCCACCTGGCGCGGCACTTCTGGAGGACTCCTCCATGATCCACCAAGTGAAATTGCCAAAGATGGC

CGACTGGAGGCCTTGCTGGATGAGTGCACCAACCCCAAGAAACGCTATGGCCGGTTCCAGGCCGCAAAAGAACTGCGTGGCTATCTGGCACAG AAGTCA

CAATGTGAGGTAGTCAGCAGTGATCTTTACATTTTCTTTGCTGAAAAAGCACTGACAAAACTAAACCACCAAAAAAACTGCCTAGAATAA
Translation
MWRLVPLKLGRLSRALKLAALGSLLVLMLLHSPSLLASWQRNELADRRFLQLNKCPACFGTSWCRRFLNGQVGFETWGRLRLLDFLNVKNVYFAQYGEPR

EGGRRRVVLKRLGSQRELAQLDQSICKRATGRPRCDLLQAMPRTEFARLNGDVRLLTPEAVEGWSDLVHCPSQRLLDRLVRRYAETKDSGSFLLRNLKDS

ERMQLLLTLAFNPEPLVLQ SFPSDEGWPFAKYLGACGRMVAVNYVGEELWSYFNAPWEKRVDLAWQLMEIAEQLTNNDFEFALYLLDVSFDNFAVGPRD

GKVIIVDAENVLVADKRLIRQN - UNI19868 - NKPENWDVWYESKFDDCDKEACLSFSKEILCARVTVDHNYYAVCQNLLSRHATWRGTSGGLLHD

PPSEIAKDGRLEALLDECTNPKKRYGRFQAAKELRGYLAQ KSQCEVVSSDLYIFFAEKALTKLNHQKNCLE
Transcript ENSMUST00000113028
Sequence
GGAGTCGGAGGGCGGGGAGCTCGGAGGAGGGCACCGGGAGTTGTGGAGACAGCCGATCGGGAAGTCGCCGCGCTCGGCCGGCGCAGCCCGTCCTCGGGTT

CCTTCGCTGCCGCCCTCCGTCTGCGCCGCGGGCCTCGGCGCCGTGGGGCGGCCCGGCGGGGTGCGCTCGCCCGCCCCGGCCCCGGCCGCTGCCGCGCGCG

GGCGGGATGTGGCGCCTGGTGCCCCTGAAGCTGGGCCGCCTGTCCCGTGCACTGAAGCTGGCGGCGCTCGGCAGCCTGTTGGTGCTGATGCTGCTGCACT

CGCCGTCGCTGCTCGCCTCCTGGCAGCGCAACGAGCTCGCCGACCGGCGCTTCCTGCAGCTCAATAAGTGCCCGGCGTGCTTCGGCACGAGCTGGTGCCG

CCGTTTCCTCAACGGCCAGGTGGGCTTCGAGACGTGGGGCCGCCTGCGCCTGCTGGACTTCCTCAACGTGAAGAACGTGTACTTCGCGCAGTACGGCGAG

CCCCGCGAGGGCGGCCGCCGGCGCGTGGTGCTCAAGCGCCTGGGTTCGCAGCGCGAGCTGGCGCAGCTCGACCAGAGCATCTGCAAGCGGGCCACCGGCC

GGCCGCGCTGCGACCTGCTCCAGGCCATGCCCCGCACCGAGTTCGCGCGTCTCAACGGCGACGTGCGGCTGCTCACGCCGGAGGCGGTGGAGGGTTGGTC

GGACCTGGTGCACTGCCCCTCGCAGCGCCTGCTGGACCGCCTGGTGCGCCGCTACGCGGAGACCAAGGACTCGGGCAGTTTCCTGCTGCGTAACCTCAAG

GACTCCGAGCGCATGCAGCTGCTGCTCACCCTGGCCTTCAACCCCGAGCCGCTGGTGCTACAG AGTTTTCCATCTGATGAAGGTTGGCCATTTGCAAAA

TATCTTGGAGCTTGTGGAAGAATGGTGGCTGTAAATTATGTTGGAGAAGAACTGTGGAGTTATTTTAATGCACCATGGGAGAAGAGAGTTGACCTTGCTT

GGCAGTTAATGGAGATAGCAGAGCAGCTTACAAACAATGACTTTGAATTTGCACTCTACCTCCTGGACGTCAGCTTTGACAACTTTGCAGTTGGTCCAAG

AGATGGGAAAGTAATCATTGTGGATGCCGAAAATGTTTTAGTTGCCGACAAAAGATTAATTAGACAAA - UNI19868 - ATAAGCCTGAGAATTGGG

ACGTATGGTATGAAAGCAAGTTTGACGATTGTGACAAGGAAGCTTGCTTGTCATTTTCAAAAGAAATCCTCTGTGCTCGTGTCACTGTGGACCACAATTA

CTATGCCGTTTGTCAGAACCTCTTATCCAGACATGCCACCTGGCGCGGCACTTCTGGAGGACTCCTCCATGATCCACCAAGTGAAATTGCCAAAGATGGC

CGACTGGAGGCCTTGCTGGATGAGTGCACCAACCCCAAGAAACGCTATGGCCGGTTCCAGGCCGCAAAAGAACTGCGTGGCTATCTGGCACAGTTAAGTC

ACAATGTGAGGTAGTCAGCAGTGATCTTTACATTTTCTTTGCTGAAAAAGCACTGACAAAACTAAACCACCAAAAAAACTGCCTAGAATAAACAAAGTGT

GGAAGTATGGCCTCGAGAATGATGAACTTCTGATAGATCTTACGTTAACACCCATCAAATAAGACATTACTGTACATCAACGTTCTCACGACGCTTCTGC

AAGTCTGTTCTTCACTTTGGAGATTGAGATACCATTGACTGCTTTTCCCCTTCCCATACCTGAGTGGATGATATTGCTAAGCTATTGGAAAGGAGTCTGA

TAGTTACATGGCTTGTGTATCAAAGGGTACTTGGTACTTAGTTTGCATTTCTACCATGATTTTGTGAATCTCTTGCATTTACTTTGAATTTCAAGTTAGA

TTGGCCTGTTTTATAGGCCACATTTTCCTTCTGATGTGTAAAATCATTTTCCATTTTTTAAAAGTTTTACGCACCCAGGTTACTATAGGTGTTCATTTAA

AATTTAATATAAGTAGTTTTCATTCCGTGCTATGCGGTACATACTTAAACTGTTAGGGCAGGACTCCCAGGTTTACTGTTTTTACAGAGATCTTAGTATT

TCACCATGTAAATAATTTGCCTCTCCCCAGCCTTCTATGCTTTTCCACTGCATGATAACATCATTTCAGGTTATTTAAGAGTTAACTCCCTCAATGCCAG

TAATTACAGGTATACACTGAACATGATGTTCAGCATATGCTACAAAACGTCACTGCATCCTTTGCTAAAAGGCTTCGAGAATAATACACTAGCAGTCTAC

ACTTCGATCGCTTTGATTGAAGAAACAATAAAAGTCAAGGTTTCTAAATGCTAACTAGTCCAAGATAGTAATGCATATGCCAAAGAAATATTAGACACAT

TCCTATGTTTAGAACTGAAAATAGAATTGGTCACCTTCGTATCCCACTTCAGTATTTTAGCTGTCACTCGTAAATTAAGATCTACCTGTCCCTTTAATGC

TGACAGTTGAGCTACTGCTTATTAAAAAAATGTATATCGTAAAGACCTTCTACCTTTTATTCATTGGTAGTTTCTCCAAAATGAACATGGTAATCATTGT

TGGAATCCAATTAGGCATCAGAACCTTTTACTAACTGATACACTAATAATTTTTACTGTAAAGCTTGTGTGCCCATTGTGATCTTCTTTACTCAGTTGCT

AGATATCAGAACATCAAATTTAAATGTGTGAGTAGAAAAATTAACAAATAATGTGTAAAATTTTTGTCTATTTAAAAACTGTTCTTTGTAAAAGTTGGCT

CTAACTAGCACAGGTAATATCTTTCTGTTTGAAGTTGTTTCTTTTGTTTGCAGTAAAGTTTGGGGTAGTGCGTTCTGGCCTGACTTACTGAAATCAGAAA

GCGATTAAAATATGCACAACCAAAGCCAAGTTTGTCCTTCTCATTCATTTAGCAACTATTTATTGTCCCTCAAGCCAGGAGCACTTGTAGCTGCTGTGCA

CCATCTGAACAGACATGGTCAAGACCATATCAAACGTGTTAGCATAGGTACTTCTTCAGTTGAAATGCCATTATTTAGGATAAACTTTCATGTTGTTTGA

TTATTGTGATGGGAATTATCTTTGTACCATCTTAAATTAGTTTGTTAATCCAAAGTGGAGGAAGACAGCAATAAAGTTAATGCAAGTTTAAAACTGGGAA

GACGGAGGGTAAGGGATGTCTATTATAAAACAGATTATTACATTGTGTTTCTTCTTATACATCCGTACATTGCATAGTTCTCAGTGAAACATTGAAGAGC

TTGCTAAGCTAACTTCTTACAAATTCCAACAGATTTTGAAGGGAGTAGGAAAAAATCATCCAAGTCTTTTGCGTCCTTAGAGCTACACTAAAGTATAGAG

TTTCAAAACAGAACACCATTATATTTTCCACCTATTCATAACATGGAGGTTGGGACTCCTAGGAGAGCCGTCTGTGGTTCCACAAACATCATCATGTTTT

TGGGGAGTGACTGTGGTTGTGGTTACAGAGCAAGAAGTCAAGAAGCCTTCCAGGCAGTGATGGCTACTTCAGGTATAACTACCATTAGAGAGGATGTGGA

ATTTCTTTTATCTTTGGGGAAGTTTTGAAAAGATAGTCAAGGAATTAGGAATTTAAAATTACAGGGAAAAATATGTATGTGAAAAGCAATAAATATTTTG

TTCTCTTTGCTATCAAGATGTTCACACTCAGATATTTATTATACAGCAACAATTTATATTTTTAATCATTGCCCATTAATAGACGCAGTGAAATATTTTT

GAATCAAAACATTTGGGGTTTGTATGTGCATTTAAATTGTCTTTTGTACTGTATGTTACTGTTTAATTTGAATATTTTATCAGAACTGTCTCCCTGTGCC

TTTATAATATAAAGTTGTTTCTGCAACTTTTAATGATCTTAATAAAGAATACTTTAAGAACCATA
Translation
MWRLVPLKLGRLSRALKLAALGSLLVLMLLHSPSLLASWQRNELADRRFLQLNKCPACFGTSWCRRFLNGQVGFETWGRLRLLDFLNVKNVYFAQYGEPR

EGGRRRVVLKRLGSQRELAQLDQSICKRATGRPRCDLLQAMPRTEFARLNGDVRLLTPEAVEGWSDLVHCPSQRLLDRLVRRYAETKDSGSFLLRNLKDS

ERMQLLLTLAFNPEPLVLQ SFPSDEGWPFAKYLGACGRMVAVNYVGEELWSYFNAPWEKRVDLAWQLMEIAEQLTNNDFEFALYLLDVSFDNFAVGPRD

GKVIIVDAENVLVADKRLIRQN - UNI19868 - NKPENWDVWYESKFDDCDKEACLSFSKEILCARVTVDHNYYAVCQNLLSRHATWRGTSGGLLHD

PPSEIAKDGRLEALLDECTNPKKRYGRFQAAKELRGYLAQLSHNVR

For any suggestions or comments, please send an email to unitrap@crg.es