Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000045427 (Hnrph2)
Chromosomal location
Chr X: 131135718 - 131141599 (+)
Description
heterogeneous nuclear ribonucleoprotein H2 Gene [Source:MGI (curated);Acc:Hnrph2-001]
RefSeq_dna
NM_019868 
RefSeq_peptide
NP_063921.1 
UniGene
Mm.397120 Mm.315909 Mm.476198 
MGI
MGI:1201779 
Uniprot/SWISSPROT
P70333 
Uniprot/SPTREMBL
A2BDV8 Q3UR26 
Human Ortholog
ENSG00000126945 (HNRNPH2)
Omim not available
UniTrap UNI16694
Vector Insertion
Chr X: 131135873 - 131137238
Public Clones D047H04 (ggtc) E067E02 (ggtc) D049A02 (ggtc) D014F07 (ggtc) PST21675-NR (escells)
IST13065D8 (tigm)
Private Clones OST455805 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26845
Vector Insertion
Chr X: 131137502 - 131139393
Public Clones not available
Private Clones OST91827 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000050331
Sequence
GTCTATCGTCTCGCTATAGCCGTTTGAGGGAAGAAGAAGGAAAATCCCCCGGTCTCGTTGGAG - UNI16694 - CAAACATTTTTAAAGTATTTCTG

TCGACCAGATACCTGGAAGAAACTCTAACAGGGTCAAAGG ATAATTCCTTAAGGCACATACCTGAAGTGGATTTTCTGTCAGAAG - UNI26845 - 

CCACATTGAATTTGCATTGAGCCAAGCTTGCCACCAAGAGTCCATCAGTCACCATGATGCTGAGCACAGAGGGCAGGGAGGGGTTCGTGGTGAAGGTCAG

GGGCCTACCCTGGTCCTGCTCAGCCGAGGAAGTGATGCGCTTCTTCTCTGATTGCAAAATCCAAAATGGCACATCAGGTGTTCGTTTCATCTACACCAGA

GAAGGCAGACCGAGTGGTGAAGCATTTGTCGAACTTGAATCTGAAGATGAAGTGAAATTGGCTTTAAAGAAAGACAGAGAAACCATGGGACACAGATATG

TTGAAGTATTCAAATCCAACAGTGTTGAAATGGATTGGGTGTTAAAGCATACAGGTCCAAATAGTCCTGATACTGCCAATGATGGTTTTGTACGACTCAG

AGGACTCCCATTTGGCTGTAGCAAGGAAGAAATTGTTCAGTTCTTTTCAGGGTTGGAAATTGTGCCAAATGGGATGACACTGCCAGTGGACTTTCAGGGG

CGGAGCACAGGGGAAGCTTTTGTGCAGTTTGCTTCACAGGAGATAGCTGAGAAGGCCTTAAAGAAACACAAGGAAAGAATAGGGCATAGGTACATCGAAA

TCTTCAAGAGTAGCCGAGCTGAAGTCCGAACCCACTATGATCCACCTAGAAAGCTCATGACTATGCAGCGCCCGGGTCCTTACGATAGGCCAGGGGCTGG

AAGAGGGTATAATAGCATTGGCAGAGGAGCCGGGTTTGAAAGAATGAGGCGGGGTGCCTATGGTGGAGGGTATGGAGGCTATGATGACTATGGAGGTTAT

AATGACGGGTATGGTTTTGGGTCTGATAGATTTGGAAGAGACCTAAACTACTGTTTCTCAGGAATGTCTGATCATAGATATGGAGATGGTGGGTCCAGTT

TCCAGAGCACCACGGGGCACTGTGTACATATGAGGGGGTTACCATACAGAGCCACCGAGAATGATATTTACAATTTTTTCTCACCTCTTAATCCCATGAG

AGTGCACATTGAAATAGGACCTGATGGAAGAGTTACTGGTGAGGCAGATGTTGAGTTTGCTACTCATGAAGACGCTGTGGCAGCTATGGCAAAAGATAAA

GCAAATATGCAACACAGATATGTGGAGCTCTTCTTGAATTCTACCGCAGGGACAAGTGGAGGAGCTTATGATCATAGCTATGTAGAGCTCTTTTTGAATT

CTACAGCAGGGGCAAGTGGTGGTGCTTACGGTAGCCAGATGATGGGAGGGATGGGTTTATCCAACCAGTCTAGTTATGGAGGTCCGGCCAGCCAGCAGCT

GAGTGGTGGCTATGGAGGGGGTTATGGTGGTCAGAGCAGTATGAGTGGATATGACCAAGTTCTTCAGGAAAACTCAAGTGACTATCAGTCAAACCTTGCT

TAGGAAGCAAGGGACCATCCAATAACATCTACATGAATAAAAGCTATCTTTATAGGAACTGGATAGAGTAGGGAGGGTGTCTTTATATCCAGTATGATTG

GTAAATGGGAAGTACAACTGCTTCTGATCA
Translation
 - UNI16694 -   - UNI26845 - MMLSTEGREGFVVKVRGLPWSCSAEEVMRFFSDCKIQNGTSGVRFIYTREGRPSGEAFVELESEDEVKLAL

KKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKK

HKERIGHRYIEIFKSSRAEVRTHYDPPRKLMTMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGM

SDHRYGDGGSSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGA

YDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQENSSDYQSNLA
Transcript ENSMUST00000113202
Sequence
AGTTCTGGTCGTCGTCTATCGTCTCGCTATAGCCGTTTGAGGGAAGAAGAAGGAAAATCCCCCGGTCTCGTTGGAG - UNI16694 - TCCTGCAGCA

AACATTTTTAAAGTATTTCTGTCGACCAGATACCTGGAAGAAACTCTAACAGGGTCAAAGG ATAATTCCTTAAGGCACATACCTGAAGTGGATTTTCTG

TCAGAAGGTGTGGTAAATATTACCAACATGTTTTTCCAGAATAGTGCAGTTTTTAATTCTTCTGGTGAACTCTAGTTTGTGAACTGTCCGTAATGTTGAC

TTATTGTCACTGTTGAATTTCCACTATTTTTGATGGGTGTGTTAAAATGTTTATTTTCAATTTCATTTTGAATGAAGTTTGAACATGTCCCAGACTTTTT

CCCTAAACGCATGATCCTTTCACCTCTGCATTTAAGTTTGTTACTGAAGTTATAATCCGAGCATTACGCCTTTCCTTTTCCTTCGCTCCAACCTTCCCAT

GCGTAATCACCTCTCCACATTGCTCTCTTTTAAATTCTTGGCCTCTTTTTCTCTATTACATGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTTCC

TAAGACATAAATACCTCCTGCTCAGCATATCTGTGCACGCTTTGAGGCCTGATCATTTGCCATTAGGTAACCAATCGGTGTGCTTTGCTCTGGGGAAAGA

CATCGCTCTCCACTATCAGCATCCCTTAGTTGCCTGCAGTCCTGTATCCTCCTTTGTTGTGATTTGTTCGGTTTTTTTTTGGGGGATGGGGGTCTCAACT

ATGCATCCTTGGCTGACCTGGAACTCCTCCCTTTGTTGGGCATGCTGGCCTCAAACTCAGAGGCCCTCCTGCCTCTGTTTCCAGAGTGCTGAGATTAAAG

GCCCATGCCGGCACACCCATCTCAGTGGGTCATTTTTTAAAAAGATTTGTTTATTTGAGTGTTCTGCATGTATGCAGCCTGCATGACAGAAGAGGGTATA

CAGAGCAGGGCATTGGATCCCATTGATGAATGATCATGAGCCCATGTGGTTGCTGGGAATTGAACTCAGGACCTCTGGAAAAGCAGCCAGTGCTCTTAAG

CAAGCTCCTCAGTGGGTCACTTTAAAATTTGTTCATTTCACCTAGTCCTCCTTTCCTTCTGTTTGAATGCTACATTTGGGGGAGGTACGTGTCACATAGT

AATGTGAATACTGAATCATTGTGCTTGTGAAGCAAGCAAGAGTCTAGTCTACTTACATTAACTAGAACGCTCTGGAGCTGCTCTCTTTCGTGATAGTCTT

CTTGTCTTTGGAGTTCTGTCCCCTTCCACTTTGTGCTCCATTAAAAGTCTTTATAGATAGTTTTTGGATCCTGGAACACAATCAGGATAGTTTGTTTCAA

TTAACCCTTCTGTCTCCCATTGATACACGTAATCAACCAATCCTTCTATGAACGTGCCTTCTATGTAGTCTATGTATCTGCACTTTGTTGAGGACACATA

GTTCTCCTATAGAACTGTGATTCGTCCGTGGCAGAACTGTGGACTGAAGCTGGCTCCTAAAACTTGTTTAAATGTATATTAATGTCTTCCATTTATCTCT

TAGGCTTTAGTACTTCTGTATTTTATTGACTTGTATTCATTCTTTATATTTTTAGGCTATTTAATGGATTTGTTGTATTGTCTCATGAGTTTTGTTTGTC

TTTTGATTTAAAGAATATTTTCATTTTTCTATAATGGGATATAGTTGTACATTGTTATATTTAGTTTTAATTTTCTCTCTGTGATGTTAATACATTGGCT

CAGTGCAGAAAATTTAGAATATTCGAAATTATCTAAAGGAAAAAAGTATCCATGGAAACAAAAAAAAATTCCTATAGTACTGTTACCCAGAAATAACCAC

TGTTAATTAGACCTGATACATAAGAGAAATGGTATAAGCACTCGCTAAGTGAATGGATTAAAAGTTTTATGCAGTCTTTGCTCATATGGCTCCTTTGAAA

AACTTACTGATGTGAACTTGTAAAATAATAGTTTTCTTTGTTTCTCTTACTATATTATATACACTTTTTCATGACAATAGTTTTCTAATTTTTTTAAAGC

CACATTGAATTTGCATTGAGCCAAGCTTGCCACCAAGAGTCCATCAGTCACCATGATGCTGAGCACAGAGGGCAGGGAGGGGTTCGTGGTGAAGGTCAGG

GGCCTACCCTGGTCCTGCTCAGCCGAGGAAGTGATGCGCTTCTTCTCTGATTGCAAAATCCAAAATGGCACATCAGGTGTTCGTTTCATCTACACCAGAG

AAGGCAGACCGAGTGGTGAAGCATTTGTCGAACTTGAATCTGAAGATGAAGTGAAATTGGCTTTAAAGAAAGACAGAGAAACCATGGGACACAGATATGT

TGAAGTATTCAAATCCAACAGTGTTGAAATGGATTGGGTGTTAAAGCATACAGGTCCAAATAGTCCTGATACTGCCAATGATGGTTTTGTACGACTCAGA

GGACTCCCATTTGGCTGTAGCAAGGAAGAAATTGTTCAGTTCTTTTCAGGGTTGGAAATTGTGCCAAATGGGATGACACTGCCAGTGGACTTTCAGGGGC

GGAGCACAGGGGAAGCTTTTGTGCAGTTTGCTTCACAGGAGATAGCTGAGAAGGCCTTAAAGAAACACAAGGAAAGAATAGGGCATAGGTACATCGAAAT

CTTCAAGAGTAGCCGAGCTGAAGTCCGAACCCACTATGATCCACCTAGAAAGCTCATGACTATGCAGCGCCCGGGTCCTTACGATAGGCCAGGGGCTGGA

AGAGGGTATAATAGCATTGGCAGAGGAGCCGGGTTTGAAAGAATGAGGCGGGGTGCCTATGGTGGAGGGTATGGAGGCTATGATGACTATGGAGGTTATA

ATGACGGGTATGGTTTTGGGTCTGATAGATTTGGAAGAGACCTAAACTACTGTTTCTCAGGAATGTCTGATCATAGATATGGAGATGGTGGGTCCAGTTT

CCAGAGCACCACGGGGCACTGTGTACATATGAGGGGGTTACCATACAGAGCCACCGAGAATGATATTTACAATTTTTTCTCACCTCTTAATCCCATGAGA

GTGCACATTGAAATAGGACCTGATGGAAGAGTTACTGGTGAGGCAGATGTTGAGTTTGCTACTCATGAAGACGCTGTGGCAGCTATGGCAAAAGATAAAG

CAAATATGCAACACAGATATGTGGAGCTCTTCTTGAATTCTACCGCAGGGACAAGTGGAGGAGCTTATGATCATAGCTATGTAGAGCTCTTTTTGAATTC

TACAGCAGGGGCAAGTGGTGGTGCTTACGGTAGCCAGATGATGGGAGGGATGGGTTTATCCAACCAGTCTAGTTATGGAGGTCCGGCCAGCCAGCAGCTG

AGTGGTGGCTATGGAGGGGGTTATGGTGGTCAGAGCAGTATGAGTGGATATGACCAAGTTCTTCAGGAAAACTCAAGTGACTATCAGTCAAACCTTGCTT

AGGAAGCAAGGGACCATCCAATAACATCTACATGAATAAAAGCTATCTTTATAGGAACTGGATAGAGTAGGGAGGGTGTCTTTATATCCAGTATGATTGG

TAAATGGGAAGTACAACTGCTTCTGATCACTATTGGTCAGCTTCTTTCTTCTTTTTCCTTTTTTTTTTTTTAAAAAAAAGAACAAAAATTTAAGTTTTAA

CAGTTTCGCATTACAAGCTTGTGATTCATGCTTACTGTAAAGTGAAAGTTAAGATTGTTTTCAAACTTTAAGCTCAGCAATTTTGAACACTGAAAATATT

CATCTAGGATGTAATAACAAGTTCAGTATTGACCATAACTGTCAACTCCCCTTTGAGCTTTCCTCAAGTTAGTTATGTTGTAGGAGTGTACTTAAGCAGC

AAGCATATTTAGGTTTAAAGCAGTTTCACTTACGTTAAATGTTGCTCTTATACCACAATACATCGAAAACTTCAGATGCATGTTGAAAAACATGCTTTTC

TGT
Translation
 - UNI16694 -  MMLSTEGREGFVVKVRGLPWSCSAEEVMRFFSDCKIQNGTSGVRFIYTREGRPSGEAFVELESEDEVKLALKKDRETMGHRYVEV

FKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFK

SSRAEVRTHYDPPRKLMTMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGSSFQS

TTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTA

GASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQENSSDYQSNLA
Transcript ENSMUST00000074950
Sequence
AAGCCGAGAGTTGCTCACGTGACCGAGATCTCACATGACGTAGATGCTCACGTGATCAATCGCTTACGTGAGCAGAAGTAGTTCTGGTCGTCGTCTATCG

TCTCGCTATAGCCGTTTGAGGGAAGAAGAAGGAAAATCCCCCGGTCTCGTTGGAG - UNI16694 - TCCTGCAGCAAACATTTTTAAAGTATTTCTG

TCGACCAGATACCTGGAAGAAACTCTAACAGGGTCAAAGG - UNI26845 - CCACATTGAATTTGCATTGAGCCAAGCTTGCCACCAAGAGTCCATC

AGTCACCATGATGCTGAGCACAGAGGGCAGGGAGGGGTTCGTGGTGAAGGTCAGGGGCCTACCCTGGTCCTGCTCAGCCGAGGAAGTGATGCGCTTCTTC

TCTGATTGCAAAATCCAAAATGGCACATCAGGTGTTCGTTTCATCTACACCAGAGAAGGCAGACCGAGTGGTGAAGCATTTGTCGAACTTGAATCTGAAG

ATGAAGTGAAATTGGCTTTAAAGAAAGACAGAGAAACCATGGGACACAGATATGTTGAAGTATTCAAATCCAACAGTGTTGAAATGGATTGGGTGTTAAA

GCATACAGGTCCAAATAGTCCTGATACTGCCAATGATGGTTTTGTACGACTCAGAGGACTCCCATTTGGCTGTAGCAAGGAAGAAATTGTTCAGTTCTTT

TCAGGGTTGGAAATTGTGCCAAATGGGATGACACTGCCAGTGGACTTTCAGGGGCGGAGCACAGGGGAAGCTTTTGTGCAGTTTGCTTCACAGGAGATAG

CTGAGAAGGCCTTAAAGAAACACAAGGAAAGAATAGGGCATAGGTACATCGAAATCTTCAAGAGTAGCCGAGCTGAAGTCCGAACCCACTATGATCCACC

TAGAAAGCTCATGACTATGCAGCGCCCGGGTCCTTACGATAGGCCAGGGGCTGGAAGAGGGTATAATAGCATTGGCAGAGGAGCCGGGTTTGAAAGAATG

AGGCGGGGTGCCTATGGTGGAGGGTATGGAGGCTATGATGACTATGGAGGTTATAATGACGGGTATGGTTTTGGGTCTGATAGATTTGGAAGAGACCTAA

ACTACTGTTTCTCAGGAATGTCTGATCATAGATATGGAGATGGTGGGTCCAGTTTCCAGAGCACCACGGGGCACTGTGTACATATGAGGGGGTTACCATA

CAGAGCCACCGAGAATGATATTTACAATTTTTTCTCACCTCTTAATCCCATGAGAGTGCACATTGAAATAGGACCTGATGGAAGAGTTACTGGTGAGGCA

GATGTTGAGTTTGCTACTCATGAAGACGCTGTGGCAGCTATGGCAAAAGATAAAGCAAATATGCAACACAGATATGTGGAGCTCTTCTTGAATTCTACCG

CAGGGACAAGTGGAGGAGCTTATGATCATAGCTATGTAGAGCTCTTTTTGAATTCTACAGCAGGGGCAAGTGGTGGTGCTTACGGTAGCCAGATGATGGG

AGGGATGGGTTTATCCAACCAGTCTAGTTATGGAGGTCCGGCCAGCCAGCAGCTGAGTGGTGGCTATGGAGGGGGTTATGGTGGTCAGAGCAGTATGAGT

GGATATGACCAAGTTCTTCAGGAAAACTCAAGTGACTATCAGTCAAACCTTGCTTAGGAAGCAAGGGACCATCCAATAACATCTACATGAATAAAAGCTA

TCTTTATAGGAACTGGATAGAGTAGGGAGGGTGTCTTTATATCCAGTATGATTGGTAAATGGGAAGTACAACTGCTTCTGATCACTATTGGTCAGCTTCT

TTCTTCTTTTTCCTTTTTTTTTTTTTAAAAAAAAGAACAAAAATTTAAGTTTTAACAGTTTCGCATTACAAGCTTGTGATTCATGCTTACTGTAAAGTGA

AAGTTAAGATTGTTTTCAAACTTTAAGCTCAGCAATTTTGAACACTGAAAATATTCATCTAGGATGTAATAACAAGTTCAGTATTGACCATAACTGTCAA

CTCCCCTTTGAGCTTTCCTCAAGTTAGTTATGTTGTAGGAGTGTACTTAAGCAGCAAGCATATTTAGGTTTAAAGCAGTTTCACTTACGTTAAATGTTGC

TCTTATACCACAATACATCGAAAACTTCAGATGCATGTTGAAAAACATGCTTTTCTGTAAAAAAAAATATATATAGGAGCTGTGTCTATGATTCAAAGTG

ACAACATTTGGCATGTTTGTTAATTCTAGCTTTTTGGTTTAATATCCTGTAAGGCACGTGAGTGTACACTTTCACTTTTTTTTTTAAAGATCCGGAACAA

TTTTGAGATGTGATACCAATACATTAGGAGTTTGGTCATGTTATTTGTATGGAATTCTGGGGCTTTGATTTAAACCTTACCTTGTATTGTGAATTCCATT

TAGATGTATTGTACTAAGTGAAACTTGTTAAATAAATCTTCCTTTTAAAAACTG
Translation
 - UNI16694 -  - UNI26845 - MMLSTEGREGFVVKVRGLPWSCSAEEVMRFFSDCKIQNGTSGVRFIYTREGRPSGEAFVELESEDEVKLALK

KDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKKH

KERIGHRYIEIFKSSRAEVRTHYDPPRKLMTMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMS

DHRYGDGGSSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAY

DHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQENSSDYQSNLA
Transcript ENSMUST00000113203
Sequence
CTCACGTGATCAATCGCTTACGTGAGCAGAAGTAGTTCTGGTCGTCGTCTATCGTCTCGCTATAGCCGTTTGAGGGAAGAAGAAGGAAAATCCCCCGGTC

TCGTTGGAG - UNI16694 - - UNI26845 - CCACATTGAATTTGCATTGAGCCAAGCTTGCCACCAAGAGTCCATCAGTCACCATGATGCTGAG

CACAGAGGGCAGGGAGGGGTTCGTGGTGAAGGTCAGGGGCCTACCCTGGTCCTGCTCAGCCGAGGAAGTGATGCGCTTCTTCTCTGATTGCAAAATCCAA

AATGGCACATCAGGTGTTCGTTTCATCTACACCAGAGAAGGCAGACCGAGTGGTGAAGCATTTGTCGAACTTGAATCTGAAGATGAAGTGAAATTGGCTT

TAAAGAAAGACAGAGAAACCATGGGACACAGATATGTTGAAGTATTCAAATCCAACAGTGTTGAAATGGATTGGGTGTTAAAGCATACAGGTCCAAATAG

TCCTGATACTGCCAATGATGGTTTTGTACGACTCAGAGGACTCCCATTTGGCTGTAGCAAGGAAGAAATTGTTCAGTTCTTTTCAGGGTTGGAAATTGTG

CCAAATGGGATGACACTGCCAGTGGACTTTCAGGGGCGGAGCACAGGGGAAGCTTTTGTGCAGTTTGCTTCACAGGAGATAGCTGAGAAGGCCTTAAAGA

AACACAAGGAAAGAATAGGGCATAGGTACATCGAAATCTTCAAGAGTAGCCGAGCTGAAGTCCGAACCCACTATGATCCACCTAGAAAGCTCATGACTAT

GCAGCGCCCGGGTCCTTACGATAGGCCAGGGGCTGGAAGAGGGTATAATAGCATTGGCAGAGGAGCCGGGTTTGAAAGAATGAGGCGGGGTGCCTATGGT

GGAGGGTATGGAGGCTATGATGACTATGGAGGTTATAATGACGGGTATGGTTTTGGGTCTGATAGATTTGGAAGAGACCTAAACTACTGTTTCTCAGGAA

TGTCTGATCATAGATATGGAGATGGTGGGTCCAGTTTCCAGAGCACCACGGGGCACTGTGTACATATGAGGGGGTTACCATACAGAGCCACCGAGAATGA

TATTTACAATTTTTTCTCACCTCTTAATCCCATGAGAGTGCACATTGAAATAGGACCTGATGGAAGAGTTACTGGTGAGGCAGATGTTGAGTTTGCTACT

CATGAAGACGCTGTGGCAGCTATGGCAAAAGATAAAGCAAATATGCAACACAGATATGTGGAGCTCTTCTTGAATTCTACCGCAGGGACAAGTGGAGGAG

CTTATGATCATAGCTATGTAGAGCTCTTTTTGAATTCTACAGCAGGGGCAAGTGGTGGTGCTTACGGTAGCCAGATGATGGGAGGGATGGGTTTATCCAA

CCAGTCTAGTTATGGAGGTCCGGCCAGCCAGCAGCTGAGTGGTGGCTATGGAGGGGGTTATGGTGGTCAGAGCAGTATGAGTGGATATGACCAAGTTCTT

CAGGAAAACTCAAGTGACTATCAGTCAAACCTTGCTTAGGAAGCAAGGGACCATCCAATAACATCTACATGAATAAAAGCTATCTTTATAGGAACTGGAT

AGAGTAGGGAGGGTGTCTTTATATCCAGTATGATTGGTAAATGGGAAGTACAACTGCTTCTGATCACTATTGGTCAGCTTCTTTCTTCTTTTTCCTTTTT

TTTTTTTTAAAAAAAAGAACAAAAATTTAAGTTTTAACAGTTTCGCATTACAAGCTTGTGATTCATGCTTACTGTAAAGTGAAAGTTAAGATTGTTTTCA

AACTTTAAGCTCAGCAATTTTGAACACTGAAAATATTCATCTAGGATGTAATAACAAGTTCAGTATTGACCATAACTGTCAACTCCCCTTTGAGCTTTCC

TCAAGTTAGTTATGTTGTAGGAGTGTACTTAAGCAGCAAGCATATTTAGGTTTAAAGCAGTTTCACTTACGTTAAATGTTGCTCTTATACCACAATACAT

CGAAAACTTCAGATGCATGTTGAAAAACATGCTTTTCTGTAAAAAAAAATATATATAGGAGCTGTGTCTATGATTCAAAGTGACAACATTTGGCATGTTT

GTTAATTCTAGCTTTTTGGTTTAATATCCTGTAAGGCACGTGAGTGTACACTTTCACTTTTTTTTTTAAAGATCCGGAACAATTTTGAGATGTGATACCA

ATACATTAGGAGTTTGGTCATGTTATTTGTATGGAATTCTGGGGCTTTGATTTAAACCTTACCTTGTATTGTGAATTCCATTTAGATGTATTGTACTAAG

TGAAACTTGTTAAATAAATCTTCCTTTTAAAAACTGGAAAAA
Translation
 - UNI16694 - - UNI26845 - MMLSTEGREGFVVKVRGLPWSCSAEEVMRFFSDCKIQNGTSGVRFIYTREGRPSGEAFVELESEDEVKLALKK

DRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKKHK

ERIGHRYIEIFKSSRAEVRTHYDPPRKLMTMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSD

HRYGDGGSSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYD

HSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQENSSDYQSNLA
Transcript ENSMUST00000059297
Sequence
ATAGCCGTTTGAGGGAAGAAGAAGGAAAATCCCCCGGTCTCGTTGGAG - UNI16694 - TCCTGCAGCAAACATTTTTAAAGTATTTCTGTCGACCA

GATACCTGGAAGAAACTCTAACAGGGTCAAAGG ATAATTCCTTAAGGCACATACCTGAAGTGGATTTTCTGTCAGAAG - UNI26845 - CCACATT

GAATTTGCATTGAGCCAAGCTTGCCACCAAGAGTCCATCAGTCACCATGATGCTGAGCACAGAGGGCAGGGAGGGGTTCGTGGTGAAGGTCAGGGGCCTA

CCCTGGTCCTGCTCAGCCGAGGAAGTGATGCGCTTCTTCTCTGATTGCAAAATCCAAAATGGCACATCAGGTGTTCGTTTCATCTACACCAGAGAAGGCA

GACCGAGTGGTGAAGCATTTGTCGAACTTGAATCTGAAGATGAAGTGAAATTGGCTTTAAAGAAAGACAGAGAAACCATGGGACACAGATATGTTGAAGT

ATTCAAATCCAACAGTGTTGAAATGGATTGGGTGTTAAAGCATACAGGTCCAAATAGTCCTGATACTGCCAATGATGGTTTTGTACGACTCAGAGGACTC

CCATTTGGCTGTAGCAAGGAAGAAATTGTTCAGTTCTTTTCAGGGTTGGAAATTGTGCCAAATGGGATGACACTGCCAGTGGACTTTCAGGGGCGGAGCA

CAGGGGAAGCTTTTGTGCAGTTTGCTTCACAGGAGATAGCTGAGAAGGCCTTAAAGAAACACAAGGAAAGAATAGGGCATAGGTACATCGAAATCTTCAA

GAGTAGCCGAGCTGAAGTCCGAACCCACTATGATCCACCTAGAAAGCTCATGACTATGCAGCGCCCGGGTCCTTACGATAGGCCAGGGGCTGGAAGAGGG

TATAATAGCATTGGCAGAGGAGCCGGGTTTGAAAGAATGAGGCGGGGTGCCTATGGTGGAGGGTATGGAGGCTATGATGACTATGGAGGTTATAATGACG

GGTATGGTTTTGGGTCTGATAGATTTGGAAGAGACCTAAACTACTGTTTCTCAGGAATGTCTGATCATAGATATGGAGATGGTGGGTCCAGTTTCCAGAG

CACCACGGGGCACTGTGTACATATGAGGGGGTTACCATACAGAGCCACCGAGAATGATATTTACAATTTTTTCTCACCTCTTAATCCCATGAGAGTGCAC

ATTGAAATAGGACCTGATGGAAGAGTTACTGGTGAGGCAGATGTTGAGTTTGCTACTCATGAAGACGCTGTGGCAGCTATGGCAAAAGATAAAGCAAATA

TGCAACACAGATATGTGGAGCTCTTCTTGAATTCTACCGCAGGGACAAGTGGAGGAGCTTATGATCATAGCTATGTAGAGCTCTTTTTGAATTCTACAGC

AGGGGCAAGTGGTGGTGCTTACGGTAGCCAGATGATGGGAGGGATGGGTTTATCCAACCAGTCTAGTTATGGAGGTCCGGCCAGCCAGCAGCTGAGTGGT

GGCTATGGAGGGGGTTATGGTGGTCAGAGCAGTATGAGTGGATATGACCAAGTTCTTCAGGAAAACTCAAGTGACTATCAGTCAAACCTTGCTTAGGAAG

CAAGGGACCATCCAATAACATCTACATGAATAAAAGCTATCTTTATAGGAACTGGATAGAGTAGGGAGGGTGTCTTTATATCCAGTATGATTGGTAAATG

GGAAGTACAACTGCTTCTGATCACTATTGGTCAGCTTCTTTCTTCTTTTTCCTTTTTTTTTTTTTAAAAAAAAGAACAAAAATTTAAGTTTTAACAGTTT

CGCATTACAAGCTTGTGATTCATGCTTACTGTAAAGTGAAAGTTAAGATTGTTTTCAAACTTTAAGCTCAGCAATTTTGAACACTGAAAATATTCATCTA

GGATGTAATAACAAGTTCAGTATTGACCATAACTGTCAACTCCCCTTTGAGCTTTCCTCAAGTTAGTTATGTTGTAGGAGTGTACTTAAGCAGCAAGCAT

ATTTAGGTTTAAAGCAGTTTCACTTACGTTAAATGTTGCTCTTATACCACAATACATCGAAAACTTCAGATGCATGTTGAAAAACATGCTTTTCTGTAAA

AAAAAATATATATAGGAGCTGTGTCTATGATTCAAAGTGACAACATTTGGCATGTTTGTTAATTCTAGCTTTTTGGTTTAATATCCTGTAAGGCACGTGA

GTGTACACTTTCACTTTTTTTTTTAAAGATCCGGAACAATTTTGAGATGTGATACCAATACATTAGGAGTTTGGTCATGTTATTTGTATGGAATTCTGGG

GCTTTGATTTAAACCTTACCTTGTATTGTGAATTCCATTTAGATGTATTGTACTAAGTGAAACTTGTTAAATAAATCTTCCTTTT
Translation
 - UNI16694 -   - UNI26845 - MMLSTEGREGFVVKVRGLPWSCSAEEVMRFFSDCKIQNGTSGVRFIYTREGRPSGEAFVELESEDEVKLAL

KKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGMTLPVDFQGRSTGEAFVQFASQEIAEKALKK

HKERIGHRYIEIFKSSRAEVRTHYDPPRKLMTMQRPGPYDRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGM

SDHRYGDGGSSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGA

YDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQENSSDYQSNLA

For any suggestions or comments, please send an email to unitrap@crg.es