Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000045624 (Esf1)
Chromosomal location
Chr 2: 139945617 - 139996294 (-)
Description
ESF1, nucleolar pre-rRNA processing protein, homolog (S. cerevisiae) Gene [Source:MGI (curated);Acc:Esf1-001]
RefSeq_dna
NM_001081090 
RefSeq_peptide
NP_001074559.1 
UniGene
Mm.21228 Mm.401402 
MGI
MGI:1913830 
Uniprot/SWISSPROT
Q3V1V3 
Uniprot/SPTREMBL
A2APY6 B2RXU2 Q8BK69 Q8BM03 Q8K089 Q9D801 
Human Ortholog
ENSG00000212989 (AC124293.6)
Omim not available
UniTrap UNI18241
Vector Insertion
Chr 2: 139994192 - 139996212
Public Clones IST14168A5 (tigm)
Private Clones OST427055 (lexicon) OST365582 (lexicon) OST321998 (lexicon) OST299491 (lexicon)
OST77572 (lexicon) OST37803 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4892
Vector Insertion
Chr 2: 139986233 - 139989944
Public Clones AS0190 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1134
Vector Insertion
Chr 2: 139985531 - 139986118
Public Clones CC0065 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1848
Vector Insertion
Chr 2: 139980678 - 139982790
Public Clones AZ0674 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 59% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10503
Vector Insertion
Chr 2: 139964791 - 139974488
Public Clones F019B08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4438
Vector Insertion
Chr 2: 139949266 - 139949414
Public Clones AC0594 (sanger) RRJ473 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000046030
Sequence
GCGCTCCATGTGAACTCAGACTGGGATCTGAGAAGAGTGGTGGGAAACTGTGCGGTCGCCCGTCGGGCTCTCCTTGGGATTT - UNI18241 - TATT

TGGTTTCTCTGGATATTTCTTCATTAAGACTTTAAAAATGTCATCCAAACAAGAAATAATGGATGACCAGCGGTTCAGGCGGGTTTCAAAGGATCCCAGA

TTTTGGGAAATGCCAGAAAAGGAACGAAAAGTCAAAATTGACAAGAGGTTTCGAGCCATGTTCCATGATAAAAAGTTTAAATTGAACTATGCTGTTGATA

AAAGAGGTCGTCCTATCAGTCACAGCACTACAGAAGACTTGAAGCGCTTCTATGACCTTTCAGACTCTGATTCTGATCTCTCTGATGAAGAAAGCAAAAT

ACTCAGTCAGAAGAAAGCGAAGCAGAAAAAAAAACAGACCAAAAAAGAAGCAAAGTCAATTGAAAAGCCGATTGAAGAGAAAAAAAAAGAAACCAAGAAA

ACTGACCAAAAGGATTCTATAAATAAACATGACTTAAATAATTCTGAAAGAGTTCAGAAAATGAAAAACTCACAGAAACCTCAGAAGATAGATTCAGAAA

TAAGTCCCAAGAAGGATAATGAAGAATTTCTACAAAATAAAAAAAAGAAAAGGGGTACCACTGACCTTAGTGTAGAAGCTTTGCCCAAAGGAAAGCTAAG

GACCAAAGATTCCAGTACCTCTGAAATGGTGAAATCTTCAACAATGAGTTCTTCTAAGGCAAAGAGAGAAAAGCAATCAG TGGTTCCAGTCATAATGGC

AAAAGACAATGATGGTAAAATGCCTGACGAAGATGCCCTGGAGGAGGATTCAGATAGTGCTAGTGAGCTAGGAAGTGATGAGGAATCTGAAGATGAAATC

ATAAGTGATGGTAAAACCTCAGCTGATGAGGATGAAAGTGAAGAAGAAGACGAAGAAGAAGAGGAAGATAGTGAGGAGGAAGAAGAGGAGGAGGAGGAGG

ATGAAAGTGACAGTGGTCCTGATCTTGCAAGGGGTAAAGGAAATGTAGAAACTAGTTCTGAAGATGAAGATGATTTGGCAGATTTGTTTCCCGAAGAACC

TGGTTTTGAACATGCTTGGAGAGAGTTAGATAAAGACGCTCCTCGGGCTGATGAG - UNI4892 - ATTACACGTCGACTAGCAGTTTGTAACATGGA

CTGGGATAGATTAAAGGCGAAAGATTTGCTGGCTCTGTTCAACTCATTTAAGCCCAAAGGAGGAGTTGTATTTTCTGTGAAG - UNI1134 - ATATA

TCCTTCAGAGTTTGGAAAGGAGAGGATGAAGGAAGAGCAAGTTCAAGGACCAGTAGAGTTACTAAGTATTCCGGAGGATGCCCCTGAAAAGGACTG GGC

CTCTAGAGAGAAGCTAAGAGACTACCAGTTCAAACGATTGAAATACTATTATGCAGTAGCGGAGTGTGATTCTCCTGAAACAGCAAGTAAGATTTATGAA

GATTGTGATGGCCTGGAATTTGAAAGCAGTTGTTCTTTCATAGACTTAAG ATTTATACCAGATGATATTACCTTTGATGATGAGCCCAAGGATGTGGCC

TTAGAAGTTGATTTAACGGCATATAAGCCAAAGTATTTCACATCTGCTGCAATGGGAACATCAACG - UNI1848 - GTGGAGATCACTTGGGATGAG

ACTGACCATGAAAGAATCACGACGCTTAACAGGAAGTTTAAAAAGGATGAGCTTTTGGACATGGACTTTCAAGCCTACTTGGCTTCCTCTAGCGAGGATG

AAGAGGAGGTAGAAGAAGCACCAGAAG GTGAAGAAGGAGTCAACATAGGAGAAGATGGGAAGACAAAGAAAAGTCAGAAGGATGATGAAGAACAAATTG

CTAAATACAGACAGCTCTTGCAGGTTATTCAAGAAAAAGAAAAGAAAGGAAAAGAAAATGATATGGAAATGGAAATCAAATGGGTTCCAG - UNI1050

3 - GTCTTAAGGAGAGTGCAGAAGAGATGGTCAAAAACAAGTTGGAGGGAAAGGATAAACTGACCCCTTGGGAACAGTTTTTAGAGAAGAAGAAAGAGA

AGAAAAGACTGAAAAAGAAACAGAAG GCTCTTGCTGAAGAAGACAGTGAAGATGAGCTTCCTTCTGATGTTGATTTCAATGATCCCTACTTTGCTGAAG

AAGTAAAAAAAATAG GTATAAAGAAAAAATCAATGAAATCTGCAAAAGACAGCGCATCTTCAGAGGAAGAAACTGATCTGGAAAAACAAAAG - UNI4

438 - GCTGAGATGGCTTTACTTGTAATGGATGAGGAAGAGGACAGCAAGAAACACTTCAATTATGACAAGATTGTGGAGCACCAGAATCTGAGCAAAA

AGAAGAAGAAACAGCTCATGAAAAAGAAGGAGTTAGTTGAGGATGACTTTGAG - UNI4438 - GTAAATGTCAGTGATGCTCGGTTTCAGGCAATGT

ATACTTCCCACCTGTTCAATTTGGATCCCTCTGATCCTAATTTCAAGAAAACAAAAGCTATGGAAAAAATTCTGGAGGAGAAAGCTCGGCATCGAGAACG

GAAGGAAGAACTTCTTATTCAAGCAGTAGAGAGAGCACAGCAGGACACGGGAAAGCCAACACAGAAGCAACCCATGGATCCCGCCTTGTCCATGCTGATT

AAATCTGTGAAAAACAAAACAGAGCAGTTCCAAGCCAGAAAAAAACAGAGGGTCAAATAACTGCTCTCGCCTCAAGTGTACAGAAACAGTGTAAAGGATA

GTGGGAAGAACGCCACCTTTCTGAAATAGGAGAAATACCCTTTTTTGACCATTGTAAACTTGTTCTGCTTTGGGGCTGGAGAGATGGCTCAGCAATAAAG

AATACTGGTGCTTTTGCAGAGCATCCGTGTTTGGTTCCCAGCTCTCACAAGGCAGCTCACAGCCATATGTAATTTGAGAGACCCGGTGCCTTTTCCTGGC

CTCCATGGGCATGGCTGGCCCATAGTGTTTGCATAAACATAGTTACAGGCAAAATATTCACACACAGAAAATTTTAAAGTAAAATTTAGAAAAAATGTTC

CCCTTATGTAATTGTTTACCTAATTGTAAATACTTCATGTTTTATACTGTGTATTCATAGACTTGCCATAATGTAATTATATATACTATAGAATTCTTAA

GAATTTTATATTATATGAAGTTCATTTCATATAAGTACAGTTATTCAAGCTTCCTAAGATGCTATTTACAATCTATGTAAAATAGTGTCAATTTTTTCTC

TGTAAAGAATAAAAACAAGTTGAAAATATGTATATGTAGTACCTTAATCTCTGAAGGCAGGAAGCAGATCTCTGAAGCTAGTAAAATAATTTATTTTTCT

AGTGTGAAAGATGGAAGCTGTGAACTTTCTTTCTGTGCTTAGTAATTTGCATGTAGAACTAATTTATAAATAAAAAGTGTGAAATGAAATT
Translation
 - UNI18241 - MSSKQEIMDDQRFRRVSKDPRFWEMPEKERKVKIDKRFRAMFHDKKFKLNYAVDKRGRPISHSTTEDLKRFYDLSDSDSDLSDEES

KILSQKKAKQKKKQTKKEAKSIEKPIEEKKKETKKTDQKDSINKHDLNNSERVQKMKNSQKPQKIDSEISPKKDNEEFLQNKKKKRGTTDLSVEALPKGK

LRTKDSSTSEMVKSSTMSSSKAKREKQSV VVPVIMAKDNDGKMPDEDALEEDSDSASELGSDEESEDEIISDGKTSADEDESEEEDEEEEEDSEEEEEE

EEEDESDSGPDLARGKGNVETSSEDEDDLADLFPEEPGFEHAWRELDKDAPRADE - UNI4892 - ITRRLAVCNMDWDRLKAKDLLALFNSFKPKGG

VVFSVK - UNI1134 - IYPSEFGKERMKEEQVQGPVELLSIPEDAPEKDW WASREKLRDYQFKRLKYYYAVAECDSPETASKIYEDCDGLEFESSC

SFIDLR RFIPDDITFDDEPKDVALEVDLTAYKPKYFTSAAMGTST - UNI1848 - VEITWDETDHERITTLNRKFKKDELLDMDFQAYLASSSEDE

EEVEEAPEG GEEGVNIGEDGKTKKSQKDDEEQIAKYRQLLQVIQEKEKKGKENDMEMEIKWVPG - UNI10503 - GLKESAEEMVKNKLEGKDKLT

PWEQFLEKKKEKKRLKKKQK ALAEEDSEDELPSDVDFNDPYFAEEVKKIG GIKKKSMKSAKDSASSEEETDLEKQK - UNI4438 - AEMALLVMD

EEEDSKKHFNYDKIVEHQNLSKKKKKQLMKKKELVEDDFE - UNI4438 - VNVSDARFQAMYTSHLFNLDPSDPNFKKTKAMEKILEEKARHRERKE

ELLIQAVERAQQDTGKPTQKQPMDPALSMLIKSVKNKTEQFQARKKQRVK
Transcript ENSMUST00000089354
Sequence
ATGAAGAAAGCAAAATACTCAGTCAGAAGAAAGCGAAGCAGAAAAAAAAACAGACCAAAAAAGAAGCAAAGTCAATTGAAAAGCCGATTGAAGAGAAAAA

AA GAAACCAAGAAAACTGACCAAAAGGATTCTATAAATAAACATGACTTAAATAATTCTGAAAGAGTTCAGAAAATGAAAAACTCACAGAAACCTCAGA

AGATAGATTCAGAAATAAGTCCCAAGAAGGATAATGAAGAATTTCTACAAAATAAAAAAAAGAAAAGGGGTACCACTGACCTTAGTGTAGAAGCTTTGCC

CAAAGGAAAGCTAAGGACCAAAGATTCCAGTACCTCTGAAATGGTGAAATCTTCAACAATGAGTTCTTCTAAGGCAAAGAGAGAAAAGCAATCAG TGGT

TCCAGTCATAATGGCAAAAGACAATGATGGTAAAATGCCTGACGAAGATGCCCTGGAGGAGGATTCAGATAGTGCTAGTGAGCTAGGAAGTGATGAGGAA

TCTGAAGATGAAATCATAAGTGATGGTAAAACCTCAGCTGATGAGGATGAAAGTGAAGAAGAAGACGAAGAAGAAGAGGAAGATAGTGAGGAGGAAGAAG

AGGAGGAGGAGGAGGATGAAAGTGACAGTGGTCCTGATCTTGCAAGGGGTAAAGGAAATGTAGAAACTAGTTCTGAAGATGAAGATGATTTGGCAGATTT

GTTTCCCGAAGAACCTGGTTTTGAACATGCTTGGAGAGAGTTAGATAAAGACGCTCCTCGGGCTGATGAG - UNI4892 - ATTACACGTCGACTAGC

AGTTTGTAACATGGACTGGGATAGATTAAAGGCGAAAGATTTGCTGGCTCTGTTCAACTCATTTAAGCCCAAAGGAGGAGTTGTATTTTCTGTGAAG - 

UNI1134 - ATATATCCTTCAGAGTTTGGAAAGGAGAGGATGAAGGAAGAGCAAGTTCAAGGACCAGTAGAGTTACTAAGTATTCCGGAGGATGCCCCT

GAAAAGGACTG GGCCTCTAGAGAGAAGCTAAGAGACTACCAGTTCAAACGATTGAAATACTATTATGCAGTAGCGGAGTGTGATTCTCCTGAAACAGCA

AGTAAGATTTATGAAGATTGTGATGGCCTGGAATTTGAAAGCAGTTGTTCTTTCATAGACTTAAG ATTTATACCAGATGATATTACCTTTGATGATGAG

CCCAAGGATGTGGCCTTAGAAGTTGATTTAACGGCATATAAGCCAAAGTATTTCACATCTGCTGCAATGGGAACATCAACG - UNI1848 - GTGGAG

ATCACTTGGGATGAGACTGACCATGAAAGAATCACGACGCTTAACAGGAAGTTTAAAAAGGATGAGCTTTTGGACATGGACTTTCAAGCCTACTTGGCTT

CCTCTAGCGAGGATGAAGAGGAGGTAGAAGAAGCACCAGAAG GTGAAGAAGGAGTCAACATAGGAGAAGATGGGAAGACAAAGAAAAGTCAGAAGGATG

ATGAAGAACAAATTGCTAAATACAGACAGCTCTTGCAGGTTATTCAAGAAAAAGAAAAGAAAGGAAAAGAAAATGATATGGAAATGGAAATCAAATGGGT

TCCAG - UNI10503 - GTCTTAAGGAGAGTGCAGAAGAGATGGTCAAAAACAAGTTGGAGGGAAAGGATAAACTGACCCCTTGGGAACAGTTTTTAG

AGAAGAAGAAAGAGAAGAAAAGACTGAAAAAGAAACAGAAG GCTCTTGCTGAAGAAGACAGTGAAGATGAGCTTCCTTCTGATGTTGATTTCAATGATC

CCTACTTTGCTGAAGAAGTAAAAAAAATAG GTATAAAGAAAAAATCAATGAAATCTGCAAAAGACAGCGCATCTTCAGAGGAAGAAACTGATCTGGAAA

AACAAAAG - UNI4438 - GCTGAGATGGCTTTACTTGTAATGGATGAGGAAGAGGACAGCAAGAAACACTTCAATTATGACAAGATTGTGGAGCACC

AGAATCTGAGCAAAAAGAAGAAGAAACAGCTCATGAAAAAGAAGGAGTTAGTTGAGGATGACTTTGAG - UNI4438 - GTAAATGTCAGTGATGCTC

GGTTTCAGGCAATGTATACTTCCCACCTGTTCAATTTGGATCCCTCTGATCCTAATTTCAAGAAAACAAAAGCTATGGAAAAAATTCTGGAGGAGAAAGC

TCGGCATCGAGAACGGAAGGAAGAACTTCTTATTCAAGCAGTAGAGAGAGCACAGCAGGACACGGGAAAGCCAACACAGAAGCAACCCATGGATCCCGCC

TTGTCCATGCTGATTAAATCTGTGAAAAACAAAACAGAGCAGTTCCAAGCCAGAAAAAAACAGAGGGTCAAATAACTGCTCTCGCCTCAAGTGTACAGAA

ACAGTGTAAAGGATAGTGGGAAGAACGCCACCTTTCTGAAATAGGAGAAATACCCTTTTTTGACCATTGTAAACTTGTTCTGCTTTGGGGCTGGAGAGAT

GGCTCAGCAATAAAGAATACTGGTGCTTTTGCAGAGCATCCGTGTTTGGTTCCCAGCTCTCACAAGGCAGCTCACAGCCATATGTAATTTGAGAGACCCG

GTGCCTTTTCCTGGCCTCCATGGGCATGGCTGGCCCATAGTGTTTGCATAAACATAGTTACAGGCAAAATATTCACACACAGAAAATTTTAAAGTAAAAT

TTAGAAAAAATGTTCCCCTTATGTAATTGTTTACCTAATTGTAAATACTTCATGTTTTATACTGTGTATTCATAGACTTGCCATAATGTAATTATATATA

CTATAGAATTCTTAAGAATTTTATATTATATGAAGTTCATTTCATATAAGTACAGTTATTCAAGCTTCCTAAGATGCTATTTACAATCTATGTAAAATAG

TGTCAATTTTTTCTCTGTAAAGAATAAAAACAAGTTGAAAATATGTATATGTAGTACCTTAATCTCTGAAGGCAGGAAGCAGATCTCTGAAGCTAGTAAA

ATAATTTATTTTTCTAGTGTGAAAGATGGAAGCTGTGAACTTTCTTTCTGTGCTTAGTAATTTGCATGTAGAACTAATTTATAAATAAAAAGTGTGAAAT

GAAATT
Translation
MKKAKYSVRRKRSRKKNRPKKKQSQLKSRLKRKK ETKKTDQKDSINKHDLNNSERVQKMKNSQKPQKIDSEISPKKDNEEFLQNKKKKRGTTDLSVEAL

PKGKLRTKDSSTSEMVKSSTMSSSKAKREKQSV VVPVIMAKDNDGKMPDEDALEEDSDSASELGSDEESEDEIISDGKTSADEDESEEEDEEEEEDSEE

EEEEEEEDESDSGPDLARGKGNVETSSEDEDDLADLFPEEPGFEHAWRELDKDAPRADE - UNI4892 - ITRRLAVCNMDWDRLKAKDLLALFNSFK

PKGGVVFSVK - UNI1134 - IYPSEFGKERMKEEQVQGPVELLSIPEDAPEKDW WASREKLRDYQFKRLKYYYAVAECDSPETASKIYEDCDGLEF

ESSCSFIDLR RFIPDDITFDDEPKDVALEVDLTAYKPKYFTSAAMGTST - UNI1848 - VEITWDETDHERITTLNRKFKKDELLDMDFQAYLASS

SEDEEEVEEAPEG GEEGVNIGEDGKTKKSQKDDEEQIAKYRQLLQVIQEKEKKGKENDMEMEIKWVPG - UNI10503 - GLKESAEEMVKNKLEGK

DKLTPWEQFLEKKKEKK   - UNI4438 -  - UNI4438 - 

For any suggestions or comments, please send an email to unitrap@crg.es