Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000045667 (Smtnl2)
Chromosomal location
Chr 11: 72202666 - 72225215 (-)
Description
smoothelin-like 2 Gene [Source:MGI (curated);Acc:Smtnl2-001]
RefSeq_dna
NM_177776 
RefSeq_peptide
NP_808444.1 
UniGene
Mm.46732 Mm.399589 Mm.372195 
MGI
MGI:2442764 
Uniprot/SWISSPROT
Q8CI12 
Uniprot/SPTREMBL
Q5F247 Q8C3G2 
Human Ortholog
ENSG00000188176 (SMTNL2)
Omim not available
UniTrap UNI1624
Vector Insertion
Chr 11: 72217507 - 72224745
Public Clones AZ0140 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13610
Vector Insertion
Chr 11: 72216753 - 72217418
Public Clones CMHD-GT_264C6-3 (cmhd)
Private Clones OST280277 (lexicon)
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37241
Vector Insertion
Chr 11: 72213528 - 72213830
Public Clones CMHD-GT_468E7-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18852
Vector Insertion
Chr 11: 72202665 - 72204916
Public Clones not available
Private Clones OST412998 (lexicon)
Severity of mutation (?) Insertion after 91% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000050226
Sequence
CCAGTCGTCCCAAGGAGCTGCGGATCTCTCAACGTCTCCCGCGTTCTGCCCGCTGTCCGATCGGTGTGCCCCACTCGGCCATGGAGCCGTCCCCCGACGC

CGAGGAGGCGCACACAGTGCGCGAGGCGCTGGGCCGCTACGAGGCGGCGCTGGAGGGTGCGGTGCGTGCGCTGCACGAGGACATGCAGGGGCTGCAGCGC

GGCGTGGAGCGGCGCGTGGCAGAGGCGCTGCGCCTGGCCGGCCCCTTGGCTCGTACTGTGGCCGAGCTGCAGCGGGACAACCAGCGGCTGCAGGCACAGC

TCGAACGCTTGACGCGCCAGGTGGAGGCGCTGGGCTTGGCGACTGGAGTGTCCCCTGCACCCGGCACGCCCAGTCCCCCTCCGGCGGCCACAGTTACCGA

CCGCGCCCCCCGCTTGGGCACTGCACGCTTCTCCAGTCATGCCACCTTTTCGCTGTCCGGTCGAAGCCCG - UNI1624 - AGCGTGGAACATGATGA

AGCCAGTGACCTTGAGGTGAGACGTGCTTCAAATTCATGCATCTTGGAGAACGGACACCAGCTGGATGCAG - UNI13610 - GTCCAGCCAACGGAT

CCTCTGAGGTCCAAACCTCGTCAGCCCAGGAGCCCCCGAGGCCACGCCCTGTGAGCCTCTCCTTGCGGATGCCCCACCAGCCCGTCACAGCTGTCACCCG

AGTCTCCGAGAAATTCTCTGGGGAGACCTCAGCTTCAGCTCTGTCACCCACATCTGCTGCCATTGTGGGGGGCTTCACCCCAAGCCCTAGTGAGGCCATC

AGCCCTTGGACTCCCAGTCCCACTG AGAAAAGTTCCTCTTTCACTCGGTCTTTGTCTGGCTCTGGGTATGGAGCAGTGACGGCTGGCAAACGCAAGGAC

AG CCCTCCACTGGTGACCCCACCACAGTCACCCCCATCCTCGCAGCCCCCAGCTATGACTCAGGCCCCTCGCCAGGGAGAGCGTCGCAGGGAACTGGTG

AGGTCGCAGACGCTGCCTCGGACTTCAGGGGCACAGGCTCGAAAGGCGCTGTTTGAGAAGTGGGAGCAGGATACGGCGAGCAA GGGCAAAGGTGAGACC

AGGGCCAAACTAAAAAGGTCACAGAGTTTCGGTGTGGCCAGTGCCAGCAGCATCAAACAGATCCTGCTAGAGTGGTGCCGCAGCAAGACTGTGGGCTATC

AG - UNI37241 - CACGTGGACCTGCAGAATTTCTCCTCCAGCTGGAGTGACGGCATGGCCTTCTGTGCCCTGGTGCACTCCTTCTTCCCTGATGCC

TTCGACTACAATGCCCTGAGTCCCACACAAAGGCAGAAGAACTTCGAACTGGCCTTCACCATGGCTGA - UNI18852 - GAATCTGGCCAACTGTGA

GCGCCTCATTGAAGTGGAGGATATGATGGTGATGGGCCGCAAGCCGGACCCCATGTGTGTCTTCACCTATGTGCAGTCGCTCTACAACCACCTTCGTCGC

TTTGAGTAAAGCCGGCGGCCCGGAGTGGCCAGGAAGAGACTCTGAGGTCCCTCACGTTCCCCCCATGGCAGCATGATCCACACGAGGGAAGCTGCCTCTC

TGGTGTGAGCTGCTATTCGCTCTCTGGCGTGTGACCATGTGCCCCTCACACTCGTTACTGATTAAAAGTATTGATGAGGCTAAGCTGAGCCCCACAGTCC

CTCCACAGGCTGGAAGGAGAAGGAAAAACTCCAGAGTCAAAAGAAATTGGTGCTAAGTTATGATCTTCCTACAGGGAGCGCTCATGGTTTCCCTCTGGTG

AATTTGATATATTGGCTTGACAGGGTTCCACTGATTATCAAGCTTTCTTTCTTTTTTCCTATCAAAGTACCCAGAGGTTGTTTTTGTTTTTTTAACTTCC

TCACACTCTCTCTTTTTTTTTTTGTTTTGTTTTTGGTTTTTCGAGACAGGGTTTCTCTTTATAGCCCTGGCTGTCCTGGAACTCACTTTGTAGACCAGGC

TGGCCTTGAACTCAGAAATCCGCCTGCTTCTGCCTCCCAAGTGCTGGGATTAAAGGCGTGCGCCACCACCACCCCTCTGGGCCATTGCCAAGAAACAGTC

TCTAGTTCTTGGGAAGAAACAGCTTAGTCAGCCCCAGGTCCTATCTTCCTATCATCTCTTCTCTGTGGGGAGGTGGCAGGATTTCTACCTAGTCCTGGAC

GGGCTTCTGGTACTCACAGGAGACCCCACAAGTGTCCAGCTAAGGAATGGTTACCTGAGCAGTAACTGAGCAGGAGCAAGGATAGGTCCTTAGGGATGAG

AGAGTTCCCATTTGCTCCAGGTATTTATAGAAAAGGATTGCATCTGTACCATTGACCTGTTTGTACACATGTGACCTGTTTGTAAGATGTGGTGGCACTC

TTCGCTTGGGTTTGTTATTTCTGTGTGGGAAATGGGAGGAGGGTTGGGCAATAAGAGACGGCATAGATTTAAACAGAGATCTACTGAAATCATACCTTTA

TTGTTTATGTATTTAAAACCACTTGCCTGGGAGGCTGAAAGCGGCATTTGCTGTCTACCAATGTGCTTGTCCCTCAGCCATCTCTATGTTGTTGAAGGAT

TGTGAACAGAAAATTTACCCCCTGCCCATCTATCCCTTAGATATTGGCAAATATATTATGATAAAAAGTGGCCCAAAGTTGA
Translation
MEPSPDAEEAHTVREALGRYEAALEGAVRALHEDMQGLQRGVERRVAEALRLAGPLARTVAELQRDNQRLQAQLERLTRQVEALGLATGVSPAPGTPSPP

PAATVTDRAPRLGTARFSSHATFSLSGRSP - UNI1624 - SVEHDEASDLEVRRASNSCILENGHQLDAG - UNI13610 - GPANGSSEVQTSS

AQEPPRPRPVSLSLRMPHQPVTAVTRVSEKFSGETSASALSPTSAAIVGGFTPSPSEAISPWTPSPTE EKSSSFTRSLSGSGYGAVTAGKRKDS SPPL

VTPPQSPPSSQPPAMTQAPRQGERRRELVRSQTLPRTSGAQARKALFEKWEQDTASK KGKGETRAKLKRSQSFGVASASSIKQILLEWCRSKTVGYQ -

 UNI37241 - HVDLQNFSSSWSDGMAFCALVHSFFPDAFDYNALSPTQRQKNFELAFTMAE - UNI18852 - ENLANCERLIEVEDMMVMGRKPD

PMCVFTYVQSLYNHLRRFE
Transcript ENSMUST00000108500
Sequence
AGTCGTCCCAAGGAGCTGCGGATCTCTCAACGTCTCCCGCGTTCTGCCCGCTGTCCGATCGGTGTGCCCCACTCGGCCATGGAGCCGTCCCCCGACGCCG

AGGAGGCGCACACAGTGCGCGAGGCGCTGGGCCGCTACGAGGCGGCGCTGGAGGGTGCGGTGCGTGCGCTGCACGAGGACATGCAGGGGCTGCAGCGCGG

CGTGGAGCGGCGCGTGGCAGAGGCGCTGCGCCTGGCCGGCCCCTTGGCTCGTACTGTGGCCGAGCTGCAGCGGGACAACCAGCGGCTGCAGGCACAGCTC

GAACGCTTGACGCGCCAGGTGGAGGCGCTGGGCTTGGCGACTGGAGTGTCCCCTGCACCCGGCACGCCCAGTCCCCCTCCGGCGGCCACAGTTACCGACC

GCGCCCCCCGCTTGGGCACTGCACGCTTCTCCAGTCATGCCACCTTTTCGCTGTCCGGTCGAAGCCCG - UNI1624 - AGCGTGGAACATGATGAAG

CCAGTGACCTTGAGGTGAGACGTGCTTCAAATTCATGCATCTTGGAGAACGGACACCAGCTGGATGCAG - UNI13610 - GTCCAGCCAACGGATCC

TCTGAGGTCCAAACCTCGTCAGCCCAGGAGCCCCCGAGGCCACGCCCTGTGAGCCTCTCCTTGCGGATGCCCCACCAGCCCGTCACAGCTGTCACCCGAG

TCTCCGAGAAATTCTCTGGGGAGACCTCAGCTTCAGCTCTGTCACCCACATCTGCTGCCATTGTGGGGGGCTTCACCCCAAGCCCTAGTGAGGCCATCAG

CCCTTGGACTCCCAGTCCCACTG AGAAAAGTTCCTCTTTCACTCGGTCTTTGTCTGGCTCTGGGTATGGAGCAGTGACGGCTGGCAAACGCAAGGACAG

 CCCTCCACTGGTGACCCCACCACAGTCACCCCCATCCTCGCAGCCCCCAGCTATGACTCAGGCCCCTCGCCAGGGAGAGCGTCGCAGGGAACTGGTGAG

GTCGCAGACGCTGCCTCGGACTTCAGGGGCACAGGCTCGAAAGGCGCTGTTTGAGAAGTGGGAGCAGGATACGGCGAGCAA GGGCAAAGGTGAGACCAG

GGCCAAACTAAAAAGGTCACAGAGTTTCGGTGTGGCCAGTGCCAGCAGCATCAAACAGATCCTGCTAGAGTGGTGCCGCAGCAAGACTGTGGGCTATCAG

 - UNI37241 - CACGTGGACCTGCAGAATTTCTCCTCCAGCTGGAGTGACGGCATGGCCTTCTGTGCCCTGGTGCACTCCTTCTTCCCTGATGCCTT

CGACTACAATGCCCTGAGTCCCACACAAAGGCAGAAGAACTTCGAACTGGCCTTCACCATGGCTGA - UNI18852 - GAATCTGGCCAACTGTGAGC

GCCTCATTGAAGTGGAGGATATGATGGTGATGGGCCGCAAGCCGGACCCCATGTGTGTCTTCACCTATGTGCAGTCGCTCTACAACCACCTTCGTCGCTT

TGAGTAAAGCCGGCGGCCCGGAGTGGCCAGGAAGAGACTCTGAGGTCCCTCACGTTCCCCCCATGGCAGCATGATCCACACGAGGGAAGCTGCCTCTCTG

GTGTGAGCTGCTATTCGCTCTCTGGCGTGTGACCATGTGCCCCTCACACTCGTTACTGATTAAAAGTATTGATGAGGCTAAGCTGAGCCCCACAGTCCCT

CCACAGGCTGGAAGGAGAAGGAAAAACTCCAGAGTCAAAAGAAATTGGTGCTAAGTTATGATCTTCCTACAGGGAGCGCTCATGGTTTCCCTCTGGTGAA

TTTGATATATTGGCTTGACAGGGTTCCACTGATTATCAAGCTTTCTTTCTTTTTTCCTATCAAAGTACCCAGAGGTTGTTTTTGTTTTTTTAACTTCCTC

ACACTCTCTCTTTTTTTTTTTGTTTTGTTTTTGGTTTTTCGAGACAGGGTTTCTCTTTATAGCCCTGGCTGTCCTGGAACTCACTTTGTAGACCAGGCTG

GCCTTGAACTCAGAAATCCGCCTGCTTCTGCCTCCCAAGTGCTGGGATTAAAGGCGTGCGCCACCACCACCCCTCTGGGCCATTGCCAAGAAACAGTCTC

TAGTTCTTGGGAAGAAACAGCTTAGTCAGCCCCAGGTCCTATCTTCCTATCATCTCTTCTCTGTGGGGAGGTGGCAGGATTTCTACCTAGTCCTGGACGG

GCTTCTGGTACTCACAGGAGACCCCACAAGTGTCCAGCTAAGGAATGGTTACCTGAGCAGTAACTGAGCAGGAGCAAGGATAGGTCCTTAGGGATGAGAG

AGTTCCCATTTGCTCCAGGTATTTATAGAAAAGGATTGCATCTGTACCATTGACCTGTTTGTACACATGTGACCTGTTTGTAAGATGTGGTGGCACTCTT

CGCTTGGGTTTGTTATTTCTGTGTGGGAAATGGGAGGAGGGTTGGGCAATAAGAGACGGCATAGATTTAAACAGAGATCTACTGAAATCATACCTTTATT

GTTTATGTATTTAAAACCACTTGCCTGGGAGGCTGAAAGCGGCATTTGCTGTCTACCAATGTGCTTGTCCCTCAGCCATCTCTATGTTGTTGAAGGATTG

TGAACAGAAAATTTACCCCCTGCCCATCTATCCCTTAGATATTGGCAAATATATTATGATAAAAAGTGGCCCAAAGTTGATGACTTTGAGTGATCATTGT

TTTTGGGGTGTGTGTGTGCACGCGAGTGCGTGTTTCTTTCATTTATTTGTATACAATGCAAGGGGTTGGGAATAGAACCCATGTTCTCTAATATGCAAGC

AAGCTCTCACCACTGAGGCCCACCTCCTGCCCCTGCCCCTGGGGTGGTCTCTTTCATGGAAGCCCATCAAGGAGTGCTGGTTTAATTTCACAGCTGTTTG

GCAGTGGAGTTTGAATAGAAAAACCATGAGAGTCCACAAAGCTGCAGCTCTTCGCTTATTCCTCCCCAAGACTGAAGATTCATTTTAGAATTGAGTTGGA

TGTTAGCCAGAGACTTTTAAAACCTCCCTTGAAGGACCTAATATGGGCACTTTATTTCATGTAACCCCCTCTGAGTGGGGTCAGCCCTGTGTCCGAGGTG

TTGGGAGCTTAGGACAGAATGTCCTCAGGGATCCTGGGCTCTATGACAGAGCTTGCAGGTGGTTTGAGCATTTTCAGTGGCTCTGTTTGCTCAGGCTGTG

GCCTTGGTCCATCTTTTGGGTTTTCCCACAGTGGGAGCCGTTCCCTTCCTGGCTCTCTCAACATTTGTAGGCTTGGAGAGCCCTATTCTTAGCAGAGACA

CATACTGGGGCTTAGGGTTTCAAACTTAAAGCCAATAAGGGCACACTAGGGCTCTATAAACAGCGTGCCTATATGTCACTGAGTAGTTGCACATGGCAAA

GCATGCTCTCCTGAGTGGCAGACATGGATTTCTGCCTCTGCACATAAAATATAGCAGGTCTTACTGGATGAGGAATTGCTTCTCTTAAACTGTAGGAACG

GTGTCCCTTGTGTCCCGCCTTCAGAACATTACAGACTAGATAGGTTTAGGGTTGGCTCTGTGATGTTCTTGTTTACAATTGTGTGTATGCAAGTGTGTGT

TTGATGTAGAATTAAAAGTAATGTTTTGGC
Translation
MQGLQRGVERRVAEALRLAGPLARTVAELQRDNQRLQAQLERLTRQVEALGLATGVSPAPGTPSPPPAATVTDRAPRLGTARFSSHATFSLSGRSP - U

NI1624 - SVEHDEASDLEVRRASNSCILENGHQLDAG - UNI13610 - GPANGSSEVQTSSAQEPPRPRPVSLSLRMPHQPVTAVTRVSEKFSGE

TSASALSPTSAAIVGGFTPSPSEAISPWTPSPTE EKSSSFTRSLSGSGYGAVTAGKRKDS SPPLVTPPQSPPSSQPPAMTQAPRQGERRRELVRSQTL

PRTSGAQARKALFEKWEQDTASK KGKGETRAKLKRSQSFGVASASSIKQILLEWCRSKTVGYQ - UNI37241 - HVDLQNFSSSWSDGMAFCALVH

SFFPDAFDYNALSPTQRQKNFELAFTMAE - UNI18852 - ENLANCERLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLRRFE
Transcript ENSMUST00000054338
Sequence
GCCGCTACGAGGCGGCGCTGGAGGGTGCGGTGCGTGCGCTGCACGAGGACATGCAGGGGCTGCAGCGCGGCGTGGAGCGGC GTGGCAGAGGCGCTGCGC

CTGGCCGGCCCCTTGGCTCGTACTGTGGCCGAGCTGCAGCGGGACAACCAGCGGCTGCAGGCACAGCTCGAACGCTTGACGCGCCAGGTGGAGGCGCTGG

GCTTGGCGACTGGAGTGTCCCCTGCACCCGGCACGCCCAGTCCCCCTCCGGCGGCCACAGTTACCGACCGCGCCCCCCGCTTGGGCACTGCACGCTTCTC

CAGTCATGCCACCTTTTCGCTGTCCGGTCGAAGCCCG - UNI1624 - AGCGTGGAACATGATGAAGCCAGTGACCTTGAGGTGAGACGTGCTTCAAA

TTCATGCATCTTGGAGAACGGACACCAG GGATGCAG - UNI13610 - GTCCAGCCAACGGATCCTCTGAGGTCCAAACCTCGTCAGCCCAGGAGCC

CCCGAGGCCACGCCCTGTGAGCCTCTCCTTGCGGATGCCCCACCAGCCCGTCACAGCTGTCACCCGAGTCTCCGAGAAATTCTCTGGGGAGACCTCAGCT

TCAGCTCTGTCACCCACATCTGCTGCCATTGTGGGGGGCTTCACCCCAAGCCCTAGTGAGGCCATCAGCCCTTGGACTCCCAGTCCCACTG AGAAAAGT

TCCTCTTTCACTCGGTCTTTGTCTGGCTCTGGGTATGGAGCAGTGACGGCTGGCAAACGCAAGGACAG CCCTCCACTGGTGACCCCACCACAGTCACCC

CCATCCTCGCAGCCCCCAGCTATGACTCAGGCCCCTCGCCAGGGAGAGCGTCGCAGGGAACTGGTGAGGTCGCAGACGCTGCCTCGGACTTCAGGGGCAC

AGGCTCGAAAGGCGCTGTTTGAGAAGTGGGAGCAGGATACGGCGAGCAA GGGCAAAGGTGAGACCAGGGCCAAACTAAAAAGGTCACAGAGTTTCGGTG

TGGCCAGTGCCAGCAGCATCAAACAGATCCTGCTAGAGTGGTGCCGCAGCAAGACTGTGGGCTATCAG - UNI37241 - CACGTGGACCTGCAGAAT

TTCTCCTCCAGCTGGAGTGACGGCATGGCCTTCTGTGCCCTGGTGCACTCCTTCTTCCCTGATGCCTTCGACTACAATGCCCTGAGTCCCACACAAAGGC

AGAAGAACTTCGAACTGGCCTTCACCATGGCTGA - UNI18852 - GAATCTGGCCAACTGTGAGCGCCTCATTGAAGTGGAGGATATGATGGTGATG

GGCCGCAAGCCGGACCCCATGTGTGTCTTCACCTATGTGCAGTCGCTCTACAACCACCTTCGTCGCTTTGAGTAAAGCCGGCGGCCCGGAGTGGCCAGGA

AGAGACTCTGAGGTCCCTCACGTTCCCCCCATGGCAGCATGATCCACACGAGGGAAGCTGCCTCTCTGGTGTGAGCTGCTATTCGCTCTCTGGCGTGTGA

CCATGTGCCCCTCACACTCGTTACTGATTAAAAGTATTGATGAGGCTAAGCTGAGCCCCACAGTCCCTCCACAGGCTGGAAGGAGAAGGAAAAACTCCAG

AGTCAAAAGAAATTGGTGCTAAGTTATGATCTTCCTACAGGGAGCGCTCATGGTTTCCCTCTGGTGAATTTGATATATTGGCTTGACAGGGTTCCACTGA

TTATCAAGCTTTCTTTCTTTTTTCCTATCAAAGTACCCAGAGGTTGTTTTTGTTTTTTTAACTTCCTCACACTCTCTCTTTTTTTTTTTGTTTTGTTTTT

GGTTTTTCGAGACAGGGTTTCTCTTTATAGCCCTGGCTGTCCTGGAACTCACTTTGTAGACCAGGCTGGCCTTGAACTCAGAAATCCGCCTGCTTCTGCC

TCCCAAGTGCTGGGATTAAAGGCGTGCGCCACCACCACCCCTCTGGGCCATTGCCAAGAAACAGTCTCTAGTTCTTGGGAAGAAACAGCTTAGTCAGCCC

CAGGTCCTATCTTCCTATCATCTCTTCTCTGTGGGGAGGTGGCAGGATTTCTACCTAGTCCTGGACGGGCTTCTGGTACTCACAGGAGACCCCACAAGTG

TCCAGCTAAGGAATGGTTACCTGAGCAGTAACTGAGCAGGAGCAAGGATAGGTCCTTAGGGATGAGAGAGTTCCCATTTGCTCCAGGTATTTATAGAAAA

GGATTGCATCTGTACCATTGACCTGTTTGTACACATGTGACCTGTTTGTAAGATGTGGTGGCACTCTTCGCTTGGGTTTGTTATTTCTGTGTGGGAAATG

GGAGGAGGGTTGGGCAATAAGAGACGGCATAGATTTAAACAGAGATCTACTGAAATCATACCTTTATTGTTTATGTATTTAAAACCACTTGCCTGGGAGG

CTGAAAGCGGCATTTGCTGTCTACCAATGTGCTTGTCCCTCAGCCATCTCTATGTTGTTGAAGGATTGTGAACAGAAAATTTACCCCCTGCCCATCTATC

CCTTAGATATTGGCAAATATATTATGATAAAAAGTGGCCCAAAGTTGA
Translation
AATRRRWRVRCVRCTRTCRGCSAAWSG VAEALRLAGPLARTVAELQRDNQRLQAQLERLTRQVEALGLATGVSPAPGTPSPPPAATVTDRAPRLGTARF

SSHATFSLSGRSP - UNI1624 - SVEHDEASDLEVRRASNSCILENGHQ GCR - UNI13610 - RSSQRIL    - UNI37241 -  - UNI

18852 - 

For any suggestions or comments, please send an email to unitrap@crg.es