Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000045691 (Thtpa)
Chromosomal location
Chr 14: 55713672 - 55717818 (+)
Description
thiamine triphosphatase Gene [Source:MGI Symbol;Acc:MGI:2446078]
RefSeq_dna
NM_153083 
RefSeq_peptide
NP_694723.1 
UniGene
Mm.319204 
MGI
MGI:2446078 
Uniprot/SWISSPROT
Q8JZL3 
Human Ortholog
ENSG00000157306 (THTPA)
Omim not available
UniTrap UNI17735
Vector Insertion
Chr 14: 55714844 - 55716216
Public Clones not available
Private Clones OST437214 (lexicon) OST437123 (lexicon) OST411725 (lexicon) OST318308 (lexicon)
OST283911 (lexicon) OST246332 (lexicon) OST206978 (lexicon) OST158246 (lexicon)
OST99886 (lexicon) OST67088 (lexicon) OST42373 (lexicon)
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000050575
Sequence
GGAAAAATGCAGGATGAACAGCGGGCAAGAGGAAGCTCTCTCTTCTCTTGCCCACCGGGTTGGGTCGCACGTAACCTAACAGACCTCTCAGGCCTAGCTT

GTCATCGGCACCGCCACACCGGTCTAATATGGCCGCTAGTGCTGGGACCGGTCTCGCGCGTAAAGAGCCTGGACTAAGGTCCGGAGCCGGAGACCGCTCC

CGGCATTCCTCGCGGGTGTAGCGTGGGCACCCTTCCCCCACTTCCGGGTCCCGGGAGAAGGAGACCCTGGGGTCTTGAAGAGTGTCCCGAGGTACCGCTG

TTTGGTGCTAGGCGAAGAATGGCAGATCATCCTGGGCAGTGAATCACTGGCCTTGGGTAGCAAGGTGTAGCGAGAAGATAGGTCATCAGCATTACGGCCT

GTTTGCTAGGGAGCCTTTTGGGTTATCAGTAGTAGGATTTAACTGGAGACTTGTCACCATTGTTGCAGCCCGCAGAGACCTCCAAGTAGAGCCCTGTGAA

CCTGGAGCAGAGCTCTGGGACAGTGTATATGCATCTTAAATTGATCCAGGACTAGTCCGTCTTTGCTGACTAGTCCTCACCTTGAGCACTCAGTGAATAC

CTGGCAAACAGGGTTGCAGGTTAATATGGCCCAGGGCTTGATTGAAGTGGAGCGAAAGTTCGCTCCAGGGCCTGACACGGAGGAAAGGCTGCAGGAGTTG

GGGGCCACCCTGGAGCACCGGGTCACCTTCCGAGACACATACTATGATACCTCTGAGTTAAGCCTTATGCTGTCTGACCACTGGCTGCGACAACGAGAAG

GTAGTGGATGGGAGCTCAAATGTCCTGGAGTAACAGGTGTCTCAGGACCTCACAATGAGTATGTGGAAGTCACATCGGAAGCTGCGATTGTGGCCCAGCT

CTTTGAACTGCTCGGGTCTGGGGAGCAGAAGCCTGCAGGTGTGGCTGCTGTCCTGGGCTCGCTGAAGCTGCAGGAGGTGGCTAGTTTTATTACTACGCGA

AGCTCCTGGAAGCTGGCCTTATCTGGAGCCCATGGACAGGAGCCTCAGCTCACAATAGACTTGGATTCAGCGGACTTCGGCTATGCTGTGGGTGAGGTAG

AGGCCATGGTGCACGAGAAGGCTGAAGTCCCGGCTGCCCTAGAGAAGATCATCACCGTCAGTAGCATGCTTG - UNI17735 - GAGTGCCAGCACAG

GAGGAGGCACCAGCCAAGCTCATGGTATACCTACAGCGCTTCAGGCCTCTGGACTATCAGCGCCTGCTAGAAGCAGCCAGTTCTGGTGAGGCCACAGGGG

ACTCAGCATCCTGACAACAGCGTTCACTTTCCAAAAGGGAAGGTAACTCTGAAGCCGCCATTCACATCCGGACCCACGGTGCTCCTTTCCCTTACAACGG

AGCCACTTTCCCCTCCAGCTCTGCCTGGTCTTTCGCCCACTCTGAGCTATCCTTCCTGGAGCCCTCCCTGGCTGCTTCCCTCATCCGTCAGATGCAATCT

GTGGGCCGCCCCTCTCCCCTGGCCGCTAAGCAGCCTCCATTGATTTCCGCTCGTGTTTATAGGATTTCCACTTAGCCGTGATCAGTAGTTAAGCACAGGA

AAATCCCTTGCCACCCCCCCCTCCCTTGGTCGATGCCATTGATTCTGCCAGAGGCTCTGAAGCCGCCTTACAGCTGAGTTAGAGATGAGGGGAAACAGCG

GGGATTTCCCTGCCCTGGGGTGTAGGGAAGAGCAAGAAGGTGGGGAAAAGGTTAGGAACTCCTTAAGGGATCTAGAAATTCAGGGCCTGCTGCTGTGCCG

GGAGGGTAGAGTGCTCAGTGTGGCAGTTTAGAGAGAACATTTGCTCTCCAACCCAGAGAGGGGTAGAAAGAAAATGGTCATTGTTGAGACCGGTTCCTAG

GGTTTCAGGAAGTCATACTTCCTGTGGAGAAGGCACCACCCTTGCTCTTAACACATTTTTTTTTCTCTCAACTAGGTCAAAACAGGCCTCTCTTCCCTTC

TCACGCTTCATAGACTTTATTTGTTGGGGAGGAGGCAGGCTCTCTATATTGCCTTGACAAATATAGGGTCTGAGTGCCACCTGCTGGTGGCCCTCAGGGT

TGTGTCCCAAGCTGAGGGTGCAGAAAGATTTGAGAGGAGCCGAGGCAGTTATGAGGCAGGCAAGCTTAGGGAACAGGTTAGCAGCCTGGAACTCCACTTG

GTTTGAGCTATGCACACCTCTCATCTCACTGCCACTTGGCATCTTAGGACCCTCAGCTGCACGCACCATGCACACACATTCTTCTAACAGTGCAGCCAGG

ACCCCGCCTGTATCGAGTAGCACTTAGAGCCCACTTCAGACAGTAAATCTCTCTTTCCCCAGCAGCCATCAAAACTCCCCTTCTGTGGACAGTTTTATTC

AAACACTTTAGGACATACCCCAAAGTAGGGAGCTGATTAGGCCTAAACGGGTTTGGGGTAACCTGTGATCTTTGGGTGACCTTTTGAGGAGAACTCCCTA

TGGACCGTCCTATGCCTGTGCAGAATGAGTTAGCTTATGATTAAAGTCAGCTGCATCATGGGAAGGGTTACGCACAGAGAAGAAAGGCTGACAGAATCCA

AGCCTGTCAATGAAAACAGAGAATCACTCAAATTATGCCACTTCACAGCTAACACCTTCGTTCCCTGAGACTTTATTAAAGGAACACCGGGTGACTGCCC

TGGGCTCTTAAGACTGTGGTCATCACCCGTTTACAGAGCACTTCTAATTTGTACGCTCAGTTTGCCTTTAAATAAAGTTTACTTCGCC
Translation
MAQGLIEVERKFAPGPDTEERLQELGATLEHRVTFRDTYYDTSELSLMLSDHWLRQREGSGWELKCPGVTGVSGPHNEYVEVTSEAAIVAQLFELLGSGE

QKPAGVAAVLGSLKLQEVASFITTRSSWKLALSGAHGQEPQLTIDLDSADFGYAVGEVEAMVHEKAEVPAALEKIITVSSMLG - UNI17735 - GVP

AQEEAPAKLMVYLQRFRPLDYQRLLEAASSGEATGDSAS

For any suggestions or comments, please send an email to unitrap@crg.es