Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000045693 (Nlrp4e)
Chromosomal location
Chr 7: 24086294 - 24147289 (+)
Description
NLR family, pyrin domain containing 4E Gene [Source:MGI (curated);Acc:Nlrp4e-001]
RefSeq_dna
NM_001004194 
RefSeq_peptide
NP_001004194.1 
UniGene
Mm.415187 Mm.442342 
MGI
MGI:3056600 
Uniprot/SWISSPROT
Q66X19 
Uniprot/SPTREMBL
Q8C1H0 
Human Ortholog
not available
Omim not available
UniTrap UNI34773
Vector Insertion
Chr 7: 24106959 - 24121200
Public Clones IST14261A1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000036813
Sequence
GTCCTCAGAGGCTATGGA ATTGGAAGCCTGCGCACTAACTGGTGCCTGCTGTGAGGACCTTGCTTCTTCTTTTACCCACTGTAAGACCCTGTTGGGAAT

CAACCTGCAGGAGAACGCCTTGGACCACAGTGGATTGGTTGCACTGTTTGAGGCTATGAAACAGCAACAGTGTACCGTGAATTTACGTGG ACTTCGAAT

TACTGACTTTGATAAGGAAACCCAGGAGTTCCTGATGGCTGAGAAAGAGAAAAACCCATACTTGAGCATCTAAGCAGTGTGTAAGGCAGAAGCAGAAACA

AGGGTGGATGTTCTGGTGTGAGAAATATGGCTGTATTCTGACCTCAAACTACGTCGAACTACCTCCAAAGGAAAGAGAGCAGGATCCTTAATTTGATCCA

TTGTATACTAAACTTATAGATCATTAACATTCCAGTGAGATACATACAGTTTCTTTATCCACGCCCCCCCAACCCCCATTCAGATGTGTTTTGCAAGATA

GATGTGGCTTTTTGTTTGCACTACAGATTCAAACAGGCCGTTCAAAGACAGCGTAAAATGAATGTTTATAATGACAGTTTTTCTACACTGGTATCTTAAG

CATCGAATAAAATCTTTAAAT
Translation
SSEAME ELEACALTGACCEDLASSFTHCKTLLGINLQENALDHSGLVALFEAMKQQQCTVNLRG GLRITDFDKETQEFLMAEKEKNPYLSI
Transcript ENSMUST00000076470
Sequence
AGACACGATGGCATCATTTTTTTCTGATTTTGGCCTTATGTGGTACTTGGAAGAGCTAAACAAGAAAGAATTCATGAAATTTAAGGAATTACTCCAACAG

GAGATTTTGCAGTTGGGGCTGAAACACATTTCTTGGACCGAAGTGAAGAAGGCATCTCGTGAAGACCTTGCCAACTTACTGTTGAAACATTATGAGGAGA

AGAAAGCCTGGGATATGACCTTCAAAATCTTCCAGAAGATGAATAGGCAGGATCTCATGGAGAGGGCAGGAAGAGAGATTGCTG GACACTCAAAGTTAT

ATCAAGTTCATTTGAAGAAGAAGCTGACCCATGATTATGCCAGAAAGTTTAACATCAAAGATCAAGATTCCCTTAAGCAGAAATTTACCCAGGATGACTG

TGATCATTTTGAGAACCTTCTCATATCAAAGGCGACTGGAAAGAAGCCACACATGGTGTTTCTGCAAGGAGTGGCGGGAATTGGCAAGTCACTGATGTTG

ACAAAGTTAATGCTTGCCTGGTCAGAAGGCATGGTGTTTCAGAACAAATTCTCCTACATCTTCTACTTCTGCTGTCAAGATGTGAAGAAGATGAAGAGAG

CAAGCCTGGCAGAATTGATCTCCAAAGAGTGGCCCAACGCCTCAGCTCCCATAGAGGAGATCCTGTCCCAACCGGAGAAACTCTTATTTGTCATCGACAA

CTTGGAAGTGATGGAATGTGATATGTCTGAATGGGAGTCGGAGCTGTGTGATGACTGCATGGAGAAGCAGCCAGTGAATATACTGATGAGCAGTTTGCTC

AGGAGGAAGATGCTCCCTGAATCCTCTTTCCTCGTCTCTGCTACCCCAGAGACTTTTGAGAAAATAGAGGACAGGATTGAGTGCACAAATGTAAAAATGA

TGGCAGGATTCAATGAGAGCAGTATTAAGGTGTATTTCTACAGCTTGTTCCAAGATAGGAACAGAACCCAGGAAATTTTCAGTTTGGTGAGAGAAAATGA

GCAGCTGTTCTCTGTATGTCAAGTCCCTGTGCTCTGCTGGATGGTGGCTACTTGTCTAAAAAAAGAGATAGAGAAGGGAAGAGACCCAGTCTCAATCTGC

CGACGTATCACTTCCCTGTATACCACTTACATCTTCAATTTGTTCATTCCCCACAGTGCCCAATATCCAAGTAAGAAAAGCCAAGACCAGCTGCAGGGCT

TATGTTCTCTGGCTGCTGAGGGCATGTGGACTGACACATTTGTGTTTGCTGAGGAGGCTCTCAGGAGAAATGGGATCATGGACTCTGATATCTCCACACT

GCTGGACGTAAGGATCCTTGAAAAGAGCAAGGAATCTGAAAAATCTTACATTTTCCTCCACCCATCTATCCAGGAGGTCTGTGCTGCCATCTTTCATCTG

CTAAAGAGCCATGTAGACCATCCTAGCCAGGATGTCAAAAGTATAGAGGCACTCATATTTACATTTCTAAAGAAAGTCAAAATACAGTGGATTTTTTTTG

GCTCTTTCATCTTTGGCCTTTTACATGAATCAGAACAAAAAAAGCTAGAGGCATTTTTTGGCCACCAGTTGTCCCAAGAAATAAAACGTCAGTTGTATCA

GTGCCTGGAAACCATAAGTGGCAATAAAGAGCTTCAAGAACAGATAGATGGCATGAAGCTGTTTTACTGTCTGTTTGAGATGGACGATGAAGCCTTCTTA

CCACAAGTTATGAACTGTATGGAACAGATTAAATTTGTGGCTAAGGATTATTCTGATGTTATTGTTGCTGCCCACTGCTTACAACACTGTTCTACACTGA

AAAAACTATCCTTGTCAACCCAGAATATCCTGAGTGAAGGTCAAGAACACAGCTATAC - UNI34773 - GGAAAAGCTACTCATCTGTTGGCATCAT

GTGTGCTCTGTGCTCACAAGCAGTAAGGATATCCACGTACTCCAAGTGAAAGACACTAATTTCAATGAAAGAGCCTTTTTGGTCTTGTATAGTCATCTGA

AGTACCCCAGCTGCATCCTTAAAGTACTTGA GGTAAATAATGTGACTTTGCTTTGTGATAACCGCCTGTTATTTGAGTTGATTCAGAACCAACGTTTGC

AGCTCTTGAACCTCAGCCTCACATTCCTGTCCCACAATGATGTGAAACTGTTGTGTGATGTCTTGAACCAGGCAGAGTGCAACATAGAAAAGCTGAT GG

TAGCAGACTGTAACCTTTCACCTGATGACTGCAAGGTCTTTGTCTCCGTCCTGATCAGCAGCAAGATGTTGAAGCATCTTAATTTGTCATCTAACAACTT

GGACAAAGGGATATCCTCTCTGTCCAAGGCTTTGTGCCACCCAGACTGTGTTCTGAAGAACTTGGT GTTAGCCAAATGTTCCCTCAGTGAGGAATGTTG

GCACTACCTTTCAGAAGTTCTTAGGCGGAACAAAACCTTGACCCACCTAGATATCAGCTTCAATGACCTAAAGGACGAAGGGCTGAAGGTTCTCTGTGGG

GCTCTCACTCTCCCAGACAGTGTCCTCATATCACTGAG TGTAAGATATTGTCTCATCACCACTAGTGGTTGCCAGGACCTGGCTGAAGTCTTGAGAAAC

AACCAGAACCTGAGGAACCTACAGATTTCAAACAATAAAATAGAAGATGCTGGTGTGAAGCTCCTGTGTGATGCTATAAAACATCCCAACTGCCACTTAG

AAAATATTGG ATTGGAAGCCTGCGCACTAACTGGTGCCTGCTGTGAGGACCTTGCTTCTTCTTTTACCCACTGTAAGACCCTGTTGGGAATCAACCTGC

AGGAGAACGCCTTGGACCACAGTGGATTGGTTGCACTGTTTGAGGCTATGAAACAGCAACAGTGTACCGTGAATTTACGTGG ACTTCGAATTACTGACT

TTGATAAGGAAACCCAGGAGTTCCTGATGGCTGAGAAAGAGAAAAACCCATACTTGAGCATCTAA
Translation
MASFFSDFGLMWYLEELNKKEFMKFKELLQQEILQLGLKHISWTEVKKASREDLANLLLKHYEEKKAWDMTFKIFQKMNRQDLMERAGREIAG GHSKLY

QVHLKKKLTHDYARKFNIKDQDSLKQKFTQDDCDHFENLLISKATGKKPHMVFLQGVAGIGKSLMLTKLMLAWSEGMVFQNKFSYIFYFCCQDVKKMKRA

SLAELISKEWPNASAPIEEILSQPEKLLFVIDNLEVMECDMSEWESELCDDCMEKQPVNILMSSLLRRKMLPESSFLVSATPETFEKIEDRIECTNVKMM

AGFNESSIKVYFYSLFQDRNRTQEIFSLVRENEQLFSVCQVPVLCWMVATCLKKEIEKGRDPVSICRRITSLYTTYIFNLFIPHSAQYPSKKSQDQLQGL

CSLAAEGMWTDTFVFAEEALRRNGIMDSDISTLLDVRILEKSKESEKSYIFLHPSIQEVCAAIFHLLKSHVDHPSQDVKSIEALIFTFLKKVKIQWIFFG

SFIFGLLHESEQKKLEAFFGHQLSQEIKRQLYQCLETISGNKELQEQIDGMKLFYCLFEMDDEAFLPQVMNCMEQIKFVAKDYSDVIVAAHCLQHCSTLK

KLSLSTQNILSEGQEHSYT - UNI34773 - TEKLLICWHHVCSVLTSSKDIHVLQVKDTNFNERAFLVLYSHLKYPSCILKVLE EVNNVTLLCDNR

LLFELIQNQRLQLLNLSLTFLSHNDVKLLCDVLNQAECNIEKLM MVADCNLSPDDCKVFVSVLISSKMLKHLNLSSNNLDKGISSLSKALCHPDCVLKN

LV VLAKCSLSEECWHYLSEVLRRNKTLTHLDISFNDLKDEGLKVLCGALTLPDSVLISLS SVRYCLITTSGCQDLAEVLRNNQNLRNLQISNNKIEDA

GVKLLCDAIKHPNCHLENIG GLEACALTGACCEDLASSFTHCKTLLGINLQENALDHSGLVALFEAMKQQQCTVNLRG GLRITDFDKETQEFLMAEKE

KNPYLSI

For any suggestions or comments, please send an email to unitrap@crg.es