Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000045896 (Paip2b)
Chromosomal location
Chr 6: 83756056 - 83781735 (-)
Description
poly(A) binding protein interacting protein 2B Gene [Source:MGI Symbol;Acc:MGI:2386865]
RefSeq_dna
NM_146169 
RefSeq_peptide
NP_666281.2 
UniGene
Mm.404420 Mm.473572 
MGI
MGI:2386865 
Uniprot/SWISSPROT
Q91W45 
Human Ortholog
ENSG00000124374 (PAIP2B)
Omim not available
UniTrap UNI27153
Vector Insertion
Chr 6: 83781323 - 83781628
Public Clones not available
Private Clones OST68341 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24707
Vector Insertion
Chr 6: 83764864 - 83781264
Public Clones (sanger)
Private Clones OST209344 (lexicon) OST145066 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26497
Vector Insertion
Chr 6: 83760070 - 83764715
Public Clones not available
Private Clones OST114495 (lexicon) OST103571 (lexicon)
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000058383
Sequence
GTGTGAGGCCGAGGTACCTCGAGCGTTTGTGCGCCGAGGCTCGCGCTCTTAGGAGGCGGCGCTGTGCTGTGGTGCGGACCTCGGGGCGGCGTTGTCCGCG

CGGCCAG - UNI27153 - GCACCTGGAAGGGTGAAGGCGAGAGGCAGATGACGACGCTGAACACAGGCTCCGCAAG - UNI24707 - AATCTCC

ATAATGAATGGATCCAGTGTGGCAAGTACATCACCCAGTGTGAAATGCAAAGAAGACCAAGGATTAAATGGACATGAGGAAAAGGAAAACCCATTTGCAG

AATACATGTGGATGGAAAATGAAGAGGATTTCAACAGACAG - UNI26497 - GTGGAGGAAGAGCTACAGGAGCAAGACTTCTTGGACCGCTGCTTC

CAGGAGATGCTGGATGAAGAGGACCAGGACTGGTTCATCCCAGCACGAGACCTGCCTCAGGCTGTGGGGCACTTACAACAGCAGTTAAATGGACTATCAG

TTGGTGACAGTCATGAATCTGAAGACATTTTG AGCAAAAGTAACCTGAATCCAGATGCCAAGGAGTTTGTTCCAGGAGTGAAGTACTGAGCTGTTGGAA

GCTTCCAGAAGGACTTGTCTTGTCCCCGTACCTGGGGCCAGCAATGCACAAAAAGGGCGGAGCTGAAGGGGGGTGGCAAGGGTGTGCAGCCAGGGCGGGT

TGGGTTGGGAAGGTGGTTTAACTGGATATTGTGACTCTGAGTAACTAATGTGCGAGGTACAACTCTCCAAGCCTGAGCATGGCTCTTCTGTTGTGCAGAC

TTGCTCAGAGCAGTTTCCAATTTATTTTATTTTTGATGAGCTCTTTGGAGTTAAGGAACTGCGATTGTTTTTCCCTTGTAAGGAATGTTGTCTGCATTTT

AGCAAAATAAGCTGACCAAGGAAAACAGTATTTAAGAATAATTTTCCCTGCTGTGTACCTACCAGCAGCAGGGTTCCTGGAGAACTTAAGGAGTTTGCAG

CTGGGTGATAAGGGGGAAAACATGAGATACAAACCAGATATAACATGCAGCTCCCATCCCCTGATATTTCCATGATGAACTGGGATACCAGTGGCCCATA

AAGCTCTTGTCTCCTGTCCTGAACTCAGCTCAAGAGAACACAGATTTGAAAGTTCTTGGATGACTGTAACTTTGGATGGATGTGAGTTGTATATCAGAAA

AGCAGGGCTTGATGGTGATTGTCATTAGTGACTGCTATCCTATCATTAGTATGTAGCTATTGTCACTCATCAGGGTTGCTTTGCCTTCATGATCTTCATG

GGGGCTGCTTCTGGCTTCTTTCCCCCCTCAGCTCTAAAAGACACTATTAGTCAAAGTCTGAGATGGGCCTTCAGTTGTGTTAGTTACACCTTGAACCTTT

TCTGGACAGTTTTGTTTTCCTAAGTCCCTTCAATATCTGATTCTTAGGATGTCTTAATTCCCTTATATTTTCTGTGTTTCCAGACACTAACAAGCTGCTT

AGTTTGGGTTTTTCTCATGCCTTACAGAGTGATTTCCAGAAACTAAGGTGCTGAGGGGTCCTGCCCGAGAGCACAACAATCAGGCTTGCTATGTACTTGA

AGCTGTTAGTAGGTGTTACTGTTCCCACAGACCAGCTTTAGTGTCCTCATGGTCCTGCCTAGGTGCACTCTTAGTTCTAGCTCTAACTCACTAGGGTTTT

TGTTGGTGTTCTGTGGAACTGAACTGCACCAGAAGCTGCCGCTGTGAGTCGAGGTGAAGGTGGTAGTGTCTGAGGGTGAGAGAACAAGTGTCCTGTCCTG

ATCGTACTCCGAGGACAAGGGTCTTGGGAGGACTGATAGTGCTGTGGCTTCTGTGTGGCTATCACTGTGGTGAATGACAGGTCTGGAAAGATCATGCTGC

TTCCAGCAGTCCATCAGATCAGTGTATAGATATGGGCAGAGACTGGAAGGAGAGGACTGAGGTCTGGAAAGTTGAAAGTTTCCCTTTTTCATATGAACTG

GTTTGCTGAGTTTCCATTTTTTCTTGGTGCCATGGATAGAACCCAGAGTCTCACTTGTGCCAGGTTAGTCCTACCCTTGAGCTGTTCTCAACCCTCCCTT

GATTTGAACACAGCCCCAGCAGTTAAAGACAGATGTCCCTCTTTTTCCTGTTTGAGTCATCACAAGGATGGCATCTTGTGGAAGTGGCCTCCCTCTCAGG

TCACATCCTAGTGAGTAGCTCAGGGAACTTGTATGGCCAGACACACACATCAATTCAAAGCCTCTCCATCAAGAGAGAATGAAACTAGGAACTCCTTCTG

GAATGACTTTATTCCTGTTTAAGCTTTTAGCTTGGCTTGTCACCTCTAATAAGGAGAGGAGGAGGGTATGTGTAGGACATTTAAAAAGATTCTTTCTCTT

GTAGTCTCCATGAGGTCAGGCTGTATCAGGATTGCAGGAAGATCCTTCAGAATCTCTGTTTGCGTAGTGCACCTTCCTCTGAGCACCTATGGAAAGCTTA

TGCAAGCCTGAGGCAGCTTTGTTCCATCCTTCAGTTTTGCTCTTTGGAAGCCAAGCTGCTAGGAATGGTCCAAGAGGCCTGCCTCCCTCCCGCTGTGCTG

GCTCATTTTATTTGGATGTCATTCTTTATCCTGCTTTCAGGGGTGTATGCTGTTGGGTATACCTGGAATCCAAGAGCTAGTGTGTTGAGTCAACCTCAGA

GGCAGGGTGCTGACTGTAGGCTTGGGATGCAGCCAGTGAACTGGCCCTTAGTAATGTATGGAATGACTTATTCCTGTGACCCAACTCTTTTACTATCCAG

TGTTGTGAGGAAGCACAATTGTACCCGAGACTACAGACTTAGCCCCAATTACAAAAAAGTTTTGGGTTGTTTTTTTTCCTTGGAATTCTTAGATTGCTGT

GTAAATTCTTATACAGCAATAGAAAGCATTCTAAATAGCTGCTAGTCTGCCTGGTCTCAGTATTCATTTATTAGAGACTGAGTTCTGTGATTATTTGACC

CTATTAACTTTGGGGGGTGGGGAGGAAGGAATTATTCATGAATTTTGGACTACATCAGAAATCTGAGATATCCAAAGCCTTGGTACTGTAGCTCAGGGTC

AGGGGCCAGTTTCTATCTGTAGTGTACCTGACTTATGGTTATCATATAAACAAGCCAGGAGATATTCTAAGGAGAAGATTGGGTCCTTTTTATTGAACCC

AGGACCTCACATGTGTTATGCAAGCACTACACCAAGCTGTACTCCAGGCCCGTGAAAGGTTGAGACTGGGTTAGCACTATTTCCAAAGTCACAAGACCTA

TGATTGCTTCATTAAGATTGTAAGGTTAACCATGGCTTAAAAATAAATGGTTTTGGTGAACTAC
Translation
 - UNI27153 - MTTLNTGSAR - UNI24707 - RISIMNGSSVASTSPSVKCKEDQGLNGHEEKENPFAEYMWMENEEDFNRQ - UNI26497 

- VEEELQEQDFLDRCFQEMLDEEDQDWFIPARDLPQAVGHLQQQLNGLSVGDSHESEDIL SKSNLNPDAKEFVPGVKY

For any suggestions or comments, please send an email to unitrap@crg.es