Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000045967 (Gpr158)
Chromosomal location
Chr 2: 21289194 - 21752171 (+)
Description
G protein-coupled receptor 158 Gene [Source:MGI (curated);Acc:Gpr158-001]
RefSeq_dna
NM_001004761 
RefSeq_peptide
NP_001004761.1 
UniGene
Mm.406686 Mm.166647 
MGI
MGI:2441697 
Uniprot/SWISSPROT
Q8C419 
Uniprot/SPTREMBL
Q8BSU1 Q8C3D0 B1AWY4 
Human Ortholog
ENSG00000151025 (GPR158)
Omim not available
UniTrap UNI36863
Vector Insertion
Chr 2: 21321054 - 21474925
Public Clones IST14633F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33749
Vector Insertion
Chr 2: 21498674 - 21570583
Public Clones IST14694E11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102949
Sequence
GCGGCCAAGCTGTCTCTTTAAACTGCTTTCATCTGAGAGCAGAGAAAGGCAGCGCTGTGGTTTGTGGCCAAACCTAAAGGCTCTAGTTAATCAGCTGCCT

GGCTGTCTGGACTGCAGACACACGAACGTCTTCAAAGAAAACCTTGGTTCCTTGGGACTCGCCGCTGAGCTCGCGGCTTGGATCTGTGTGCGCGCTTCCA

TCTCCGGGCGAAGCGGTCGAGGAGGGGCCAGAACTGGGAGGCGGGAACGACCTGCCAAGGGTGAGATGATGGAGCAGCATCTTTGGTGGCCGCGGTGGCA

ACATCAGCTGCATCAGCAGCATCAGCATCAGCTCTTGAACACACCTCAATGAGAGCGGCGGTGGAAGCGGCTGAGCAGAAAGACGTAAGCGGGCTAACTA

TAGCTGCTGGGGATGTAACCTGTTTGGCTCAAGGCTGCGAGGTGCGTAATCCCGAGCCGACCCATTGTGGAGCCGGGCGCAGCCAGCATTGCCACAGGTG

ATTTGGTCTGTGACGGCAGCTGAGCCAGCTGGGCCAATTTCAAAACATTCTTATTTTAAAGTCCATCTGGACTGGGCGCCACCTGGAGAAGAAGGAAGCC

TCCCCTCAAAAGTCTTACTGATGATAAATTGAGGACCAAAATTTACAAAGTGACTCCTCCGGTTATCGCCTCTCTTCTATGCTAGACAGATGGGAGCCAT

GGCTTACTCTTTACTCTTCTGCCTCCTGCTCGCTCATCTGGGATTGGGAGAGGTTGGTGCCAGCCTCGACCCTCCGGGACGGCCAGATTCCCCTCGAGAG

AGGACTCCGAGGGGGAAGCAGCATGGTCAGCAGCTGCCGCGAGCCTCTGCCCCAGACCCCTCTATTCCCTGGAGCCGCTCCACTGACGGCACCATCTTGG

CACAAAAACTAGCCGAGGAGGTGCCCGTGGACGTGGCCTCTTACCTCTACACTGGGGACTTCCACCAGCTGAAGAGAGCCAACTGCTCAGGCCGCTACGA

GTTGGCTGGCCTGCCGGGAAAGTCACCGTCCCTAGCCAGCTCCCATCCTTCCTTGCACGGGGCGCTGGACACTCTGACACACGCCACCAACTTCCTCAAC

ATGATGTTGCAGAGCAATAAGTCTCGGGAACAGACCGTGCAGGATGACCTGCAGTGGTACCAGGCTCTGGTGCGAAGTCTCCTGGAGGGTGAGCCCAGCA

TCTCCCGGGCGGCCATCACCTTCAGCACCGAGTCGCTGTCCACGCCCGCCCCGCAGGTCTTCCTCCAGGCCACCCGCGAGGAGAGTCGCATCCTGCTGCA

GGACCTGTCCTCCTCCGCTCACCACCTGGCTAACGCCACTCTAGAGACCGAGTGGTTCCATGGGCTTCGGCGAAAGTGGAGGCCCCACTTGCACCGCCGT

GGCTCCAATCAGGGGCCACGGGGCCTAGGCCACAGCTGGCGGCGCAGGGATGGGCTTGGAGGGGACAGGAGCCACGTCAAGTGGTCCCCACCTTATCTGG

AGTGCGAGAATGGGAGTTACAAGCCTGGGTGGCTGGTCACGCTCTCTGCTGCCTTCTACGGGCTTCAACCTAACCTGGTCCCGGAATTCAG GGGTGTGA

TGAAAGTTGATATAAGCCTTCAGAAAGTGGACATTGACCAATGTTCGAGTGATGGCTGGTTTTCAGGAACTCACAAATGCCACCTTAACAACTCAGAG -

 UNI36863 - TGTATGCCAATCAAAGGCCTGGGATTCGTGCTTGGAGCCTATCAGTGCATTTGCAAAGCAGGGTTCTATCATCCCCGTGTCTTCTCAG

TGAACAACTTCCAGA GAAGGGGTCCAGATCACCATTTTTCAGGAAGCACAAAGGATGTGTCAGAAGAAACCCACGTCTGCCTGCCCTGCAGAGAAGGCT

GCCCCTTCTGTGCTGATGATCGTCCATGCTTTGTCCAGGAGGATAAATACCTGCGGCTCGCTATTATCTCTTTCCAAGCCCTGTGTATGCTGCTGGACTT

TGTCAGCATGCTGGTGGTCTACCATTTTCGCAAAGCAAAG - UNI33750 - AGCATCAGGGCATCTGGGCTCATCCTGTTGGAAACAATATTGTTTG

GTTCTCTGCTCCTATACTTTCCG GTCGTTATTCTGTACTTTGAGCCAAGTACATTTCGTTGTATTCTCCTAAGGTGGGCTCGTCTTCTTGGTTTTGCTA

CTGTTTATGGAACTGTGACCCTCAAGCTTCACAG GGTTTTGAAGGTGTTCCTTTCACGAACAGCACAAAGAATCCCATACATGACTGGTGGTCGGGTCA

TGAGGATGCTGGCAGTAATAGTCTTGGTTGTGTTTTGGTTTCTTGTTGGCTGGACTTCTTCTATGTGCCAGAATTTGGAGCGGGATATTTTGCTTGTTGG

CCAAGGGCAAACATCTGATCACCTCACCTTCAATATGTGCCTCATTGACCGCTGGGATTACATGACAGCAGTTG CTGAATTTTTATTCCTCTTGTGGGG

CATTTATCTCTGCTATGCAGTGCGGACTGTCCCTTCAGCATTTCATGAGCCACGCTACATGGCTGTCGCAGTTCACAATGAGCTCATTATCACGGCTATA

TTCCATACAATTAGGTGAGTGGTCCTTGGCAGTGGTACAAAAGCTGTTGTATTTGTGGTGTGTGTTGTAATTTAATTTAAATAGCAAAACTTTAAAAGAT

GAGTAATGGAAATATTTAAGGAAGATAATGCTTTATGAATACCTGATTGTGGCAGAAATGGCAGATGGTTCTAGTTGCTCTTATTCTCTTCTAATGGGTT

TTCTTTCTTCTTACTTCATTTATTTTGTGGATTAGTTCCATGTTAGTATAATATGTATACCCACTTACAAGATACTTTTATTTATATGCCATATTGAGTT

ACTGAGATGTAGAACATCACACACGTGTGTGATAAAAGAGCTATAGGTACTCACCCCCTTTATTTACATTTAATATGCTGGTCTAGACTTCCAAACTCTT

AGTACTCAGACAACTCATGTGTGGGGGCTCTACTGAGTTCTGCTCAGTGTGATAACTAGATTATTATGCATTATTTCCTGGTGTCCTCCTGCCTTAGGTG

TGATGTCTGAGCCCAGACTTTATCAACTAGCCATTGGTCTGTGCTTGTCTCATGCATCTCTACAGCAGGGGAATAGGAAGGAGGCAGACTTGCCAAATGA

AATGATGTGCATCTGACTTCTGAGACCTTTCGCATGCATCATAACTAAAAAAAAAAAAATGAGATGAAAATCTCAGGGGCCAGATAACATAAGGAACCCT

GGCATTTTATCAACAACCAAAATATAAATGTCATCCAACTGCTTAAAAAGTCCTGGAAATTAGGGTACACTTAGAACTGCATCAGAGATGCTGGATGTCT

TTGTCCTGATGTAACGGTTAGGGTTGACTCCCCTGCTGACATTCAGACTTTCCTGGAGTTGGGGTGGAACAGGAGGCTGGGAATGTGTAGAAGTTTCTCT

GAGTGCTTGTCTCTCATTTAACAAAACCTCAGAAGATACTAACTTCTGCCTTTGGGAACCAATGATGCCAGAGAAAAGTTGATACTTCCAACAACTGCAG

TTTTTAAACTTGT
Translation
MGAMAYSLLFCLLLAHLGLGEVGASLDPPGRPDSPRERTPRGKQHGQQLPRASAPDPSIPWSRSTDGTILAQKLAEEVPVDVASYLYTGDFHQLKRANCS

GRYELAGLPGKSPSLASSHPSLHGALDTLTHATNFLNMMLQSNKSREQTVQDDLQWYQALVRSLLEGEPSISRAAITFSTESLSTPAPQVFLQATREESR

ILLQDLSSSAHHLANATLETEWFHGLRRKWRPHLHRRGSNQGPRGLGHSWRRRDGLGGDRSHVKWSPPYLECENGSYKPGWLVTLSAAFYGLQPNLVPEF

R RGVMKVDISLQKVDIDQCSSDGWFSGTHKCHLNNSE - UNI36863 - CMPIKGLGFVLGAYQCICKAGFYHPRVFSVNNFQR RRGPDHHFSGST

KDVSEETHVCLPCREGCPFCADDRPCFVQEDKYLRLAIISFQALCMLLDFVSMLVVYHFRKAK - UNI33750 - SIRASGLILLETILFGSLLLYFP

 VVILYFEPSTFRCILLRWARLLGFATVYGTVTLKLHR RVLKVFLSRTAQRIPYMTGGRVMRMLAVIVLVVFWFLVGWTSSMCQNLERDILLVGQGQTS

DHLTFNMCLIDRWDYMTAVA AEFLFLLWGIYLCYAVRTVPSAFHEPRYMAVAVHNELIITAIFHTIR
Transcript ENSMUST00000055946
Sequence
GCGGCCAAGCTGTCTCTTTAAACTGCTTTCATCTGAGAGCAGAGAAAGGCAGCGCTGTGGTTTGTGGCCAAACCTAAAGGCTCTAGTTAATCAGCTGCCT

GGCTGTCTGGACTGCAGACACACGAACGTCTTCAAAGAAAACCTTGGTTCCTTGGGACTCGCCGCTGAGCTCGCGGCTTGGATCTGTGTGCGCGCTTCCA

TCTCCGGGCGAAGCGGTCGAGGAGGGGCCAGAACTGGGAGGCGGGAACGACCTGCCAAGGGTGAGATGATGGAGCAGCATCTTTGGTGGCCGCGGTGGCA

ACATCAGCTGCATCAGCAGCATCAGCATCAGCTCTTGAACACACCTCAATGAGAGCGGCGGTGGAAGCGGCTGAGCAGAAAGACGTAAGCGGGCTAACTA

TAGCTGCTGGGGATGTAACCTGTTTGGCTCAAGGCTGCGAGGTGCGTAATCCCGAGCCGACCCATTGTGGAGCCGGGCGCAGCCAGCATTGCCACAGGTG

ATTTGGTCTGTGACGGCAGCTGAGCCAGCTGGGCCAATTTCAAAACATTCTTATTTTAAAGTCCATCTGGACTGGGCGCCACCTGGAGAAGAAGGAAGCC

TCCCCTCAAAAGTCTTACTGATGATAAATTGAGGACCAAAATTTACAAAGTGACTCCTCCGGTTATCGCCTCTCTTCTATGCTAGACAGATGGGAGCCAT

GGCTTACTCTTTACTCTTCTGCCTCCTGCTCGCTCATCTGGGATTGGGAGAGGTTGGTGCCAGCCTCGACCCTCCGGGACGGCCAGATTCCCCTCGAGAG

AGGACTCCGAGGGGGAAGCAGCATGGTCAGCAGCTGCCGCGAGCCTCTGCCCCAGACCCCTCTATTCCCTGGAGCCGCTCCACTGACGGCACCATCTTGG

CACAAAAACTAGCCGAGGAGGTGCCCGTGGACGTGGCCTCTTACCTCTACACTGGGGACTTCCACCAGCTGAAGAGAGCCAACTGCTCAGGCCGCTACGA

GTTGGCTGGCCTGCCGGGAAAGTCACCGTCCCTAGCCAGCTCCCATCCTTCCTTGCACGGGGCGCTGGACACTCTGACACACGCCACCAACTTCCTCAAC

ATGATGTTGCAGAGCAATAAGTCTCGGGAACAGACCGTGCAGGATGACCTGCAGTGGTACCAGGCTCTGGTGCGAAGTCTCCTGGAGGGTGAGCCCAGCA

TCTCCCGGGCGGCCATCACCTTCAGCACCGAGTCGCTGTCCACGCCCGCCCCGCAGGTCTTCCTCCAGGCCACCCGCGAGGAGAGTCGCATCCTGCTGCA

GGACCTGTCCTCCTCCGCTCACCACCTGGCTAACGCCACTCTAGAGACCGAGTGGTTCCATGGGCTTCGGCGAAAGTGGAGGCCCCACTTGCACCGCCGT

GGCTCCAATCAGGGGCCACGGGGCCTAGGCCACAGCTGGCGGCGCAGGGATGGGCTTGGAGGGGACAGGAGCCACGTCAAGTGGTCCCCACCTTATCTGG

AGTGCGAGAATGGGAGTTACAAGCCTGGGTGGCTGGTCACGCTCTCTGCTGCCTTCTACGGGCTTCAACCTAACCTGGTCCCGGAATTCAG GGGTGTGA

TGAAAGTTGATATAAGCCTTCAGAAAGTGGACATTGACCAATGTTCGAGTGATGGCTGGTTTTCAGGAACTCACAAATGCCACCTTAACAACTCAGAG -

 UNI36863 - TGTATGCCAATCAAAGGCCTGGGATTCGTGCTTGGAGCCTATCAGTGCATTTGCAAAGCAGGGTTCTATCATCCCCGTGTCTTCTCAG

TGAACAACTTCCAGA GAAGGGGTCCAGATCACCATTTTTCAGGAAGCACAAAGGATGTGTCAGAAGAAACCCACGTCTGCCTGCCCTGCAGAGAAGGCT

GCCCCTTCTGTGCTGATGATCGTCCATGCTTTGTCCAGGAGGATAAATACCTGCGGCTCGCTATTATCTCTTTCCAAGCCCTGTGTATGCTGCTGGACTT

TGTCAGCATGCTGGTGGTCTACCATTTTCGCAAAGCAAAG - UNI33750 - AGCATCAGGGCATCTGGGCTCATCCTGTTGGAAACAATATTGTTTG

GTTCTCTGCTCCTATACTTTCCG GTCGTTATTCTGTACTTTGAGCCAAGTACATTTCGTTGTATTCTCCTAAGGTGGGCTCGTCTTCTTGGTTTTGCTA

CTGTTTATGGAACTGTGACCCTCAAGCTTCACAG GGTTTTGAAGGTGTTCCTTTCACGAACAGCACAAAGAATCCCATACATGACTGGTGGTCGGGTCA

TGAGGATGCTGGCAGTAATAGTCTTGGTTGTGTTTTGGTTTCTTGTTGGCTGGACTTCTTCTATGTGCCAGAATTTGGAGCGGGATATTTTGCTTGTTGG

CCAAGGGCAAACATCTGATCACCTCACCTTCAATATGTGCCTCATTGACCGCTGGGATTACATGACAGCAGTTG CTGAATTTTTATTCCTCTTGTGGGG

CATTTATCTCTGCTATGCAGTGCGGACTGTCCCTTCAGCATTTCATGAGCCACGCTACATGGCTGTCGCAGTTCACAATGAGCTCATTATCACGGCTATA

TTCCATACAATTAG ATTCGTGCTCGCCTCGAGACTTCAGCCCGACTGGATGCTGATGCTGTACTTTGCACATGCTCACTTGACTGTGACAGTCACCATT

GGGCTGCTTCTAATTCCAAAG TTTTCACATTCAAGCAATAATCCCCGAGATGACATTGCTACGGAAGCATATGAAGATGAGCTGGACATGGGTCGCTCT

GGATCCTACCTGAACAGCAGTATCAATTCAGCCTGGAGTGAACACAGCCTAGATCCAGAAGACATTCGG GATGAACTGAAAAAACTCTATGCTCAGTTA

GAAATATACAAACGTAAAAAGATGATCACAAACAACCCCCACCTTCAGAAAAAACGGTGCTCCAAGAAGGGCTTAGGCCGGTCCATCATGAGGCGCATCA

CTGAGATCCCAGAGACAGTCAGCAGACAGTGCTCCAAAGAGGACAAGGAAGGCACAGACCACAGTGCAGCCAAGGGGACAGGCCTTGTCCGGAAGAACCC

TACTGAGTCCTCAGGGAATACAGGGAGACCCAAGGAAGAGTCCCTTAAAAATCGGGTCTTCTCTCTCAAGAAATCCCACAGCACATATGACCATGTGAGA

GACCAAACTGTAGAATCCAGCAGCTTGCCCATGGAGAGCCAGGAGGAGGAGGCCACCGAAAATTCAACCTTGGAGTCGCTGTCAAGTAAAAAACTGACAC

AAAAGCTCAAAGAAGATAGTGAGGCCGAGTCCACTGAGTCAGTGCCGTTGGTCTGCAAGTCAGCCAGTGCTCACAACCTCAGCTCAGAGAAGAAGCCTGG

GCACCCACGTACATCTATGTTACAGAAATCTCTCAGTGTCATTGCAAGTGCCAAGGAGAAGACACTTGGCCTGGCTGGCAAAACCCAGACTTTAGTTATG

GAAGACCGAGCTAAGTCCCAGAAACCAAAAGATAGAGAGACCATCAGGAAGTACTCAAATTCAGATAATGTAGAGACTATCCCAAACTCCGGTCACATGG

AGGAGCCAAGAAAGCCCCAGAAATCTGGGATTATGAAACAGCAGAGGGTCAGCCTCCCCACTGCCAATCCTGACGTGAGCTCCGGTATCACCCAGATAAA

GGACAATTTTGATATCGGAGAAGTATGCCCTTGGGAGGTTTATGACCTGACCCCTGGTCCTATGCCTTCAGAGCCAAAAGCTCAAAAACACGTATCAATC

GCAGCTTCTGAAGTGGAACAAAACCCTGCTTCGTTTTTGAAGGAGAAGTCCTACCACAAGTCTAAGGCAACTGAAGGTCTCTACCAAGCCAATCACAAGA

GCATAGACAAGACAGAGGTGTGCCCCTGGGAAATCCACAGTCAGTCCCTTTTAGAAGATGAGAATCGTCTGATTTCTAAGACTCCAGTTCTCCCAGGGAG

AGCCAGAGAGGAGAATGGAAGCCAGCTCTACACAACCAATATGTGTGCTGGGCAATATGAAGAACTGCCCCACAAAGTCGTAGCACCAAAAGTAGAGAAT

GAAAATCTCAACCAAATGGGAGACCAGGAGAAACAGACATCTTCCTCTGTGGATATCATTCCTGGCTCCTGTAACTCAAGTAATAACTCCCATCAGCCCT

TAACATCACGAGCCGAAGTGTGTCCCTGGGAGTTCGAGCCCCTAGAACAACCAAATGCTGAAAGAAGCGTAACTTTACCTGCCTCCTCTGCTTTAAGTGC

AAATAAGATACCAGGGCCTCAGAAATAGGAAGTCTGGGACACTTTCAAAGTGGACCACCCTGGGAAGAAAGGGGTAATCCCGAGTTTGATAAAAATAGAT

CTGAAAATCACAAGTTACCAAGGCATCTTTGTTAGCCTAGGGAAACATGGCACATAGTGCAGTAAGGTGAAGGCAAGGGCTGGAGAAGGCCAGAAAAAGG

CAATTATGCATCATAAGAAGGAAGGCTGACTCTGCCATGAAAAGCCAGATCAACACTGGAGGACAGCTTAGCATTTCCGCCTGTTTAAGGGACATTGCCC

TGTCTGTCTTTACACATGGGATTGAATGGTACCAAGCAAGATTCACCAGGAGGCATGGAAGACAGACGCATGGATTTTAAGATGGGAAAACTTAGATAAA

TGTGACTGTGATTCTAAGTAGCTGACTGAAAAGCCAACCTTCATTACCTATTTAACCTTGGTAGCACTGCTAACTTAATGCACCCTGATACCTTTTATAT

ACACGATTGCTCTCATTTTCTTAAAATCTGTTCCAGTACATTGTTGTGTCTTGTATTCAAGCATTCCAGATTGTATAATTTTTGCAAATAACTTTGATAT

TATATGACACAACACATTTATGCAATCTGCAGCTACTCAATTGTCATTGCAACCTACCAAATACCTGCTATCATCTACCAAGTGTGGTTGAGTCTTGGAG

TACAGTAAGCTTTCTCTGGCTTAGGAAGCCATAACAGTTAAGATGAAAACTTTTAGTTTGGGCTGTGGTTTATATAGTGAAGTTGGGTCTGACTCTTTTG

TTTCCCACCATGGCTTGTTGTAATGTCTTAATTTTTAAATATAAGTTGAGTTGCTTATTCTACACTTCTTGTAGGGACTCTGAAGCTTTATTAATCTCGG

AGATGAAGTGGTCCTGTTTAGTCATATGTCTCAGTAAGTTAAGGACAACTTATCCATTGTTTGTTCCAAGTCAGAGCTAAATCAACCCAATGACTCTTTC

AGTATTTCACATTAGCATTTCCTAAGGAAGAAGCCGAATGAGGAAACTATGCTGTACATTGTTACCAACAGAAGAGGCCAACTCTAGGAGCGCCTTAACA

ACGAGTGCATACTGCAGGTCCAGGAAATTGCCTTTCATGACAAATACAGAAAGGTCGCTCCTAATAGCTCCAGGGATTATTTTTATAAAGAGAAAAATTA

ATGATAGCATCAAGATCATTGTATGGATATATTTTTATTATGCATACTGAAAATATATTTTAAATTACCTTAAACTATTTATTCTCATAAACTTTTATTC

ATTGCTTCATCTAGGTACAGAATTTGCTGGGCTCAAATCCCAAAGAGATTTTATAACTTGATTTACTCAAAGCCCATAGGTGGTACAGGCTCTTTACACT

CCCCAGTACCAGAACTTACAAGTCCTTCAAACTGTCCTTGCAAGCCACCTAGCTCAAAATGCAAAGCCTAAGATTGGTGTGCATACATCAAAGCATATCT

TCTAGAACTTGCTGCATTCCATGCTGATCTCTAGCATAAACATCCTGAGCTTCTGACTTAGCTCTAAGGATTGCAATGCCGAAATAAGACTCTAAAATCC

AGGCACATTTCATTTAAAGATCTATCACTTAAAACTACAGCCCAGGCTTGATTTTCTCCCATCATAAATACTAAACAACTGCTTATGTGACGAAGACATT

TCCATCCATAGGAACTGTTTTACCTTTGGTGAGCAACAAAAAGAATTTGCTAGGATGATGCAGGAGGGGAGAAGGAATCAGAAGGTGGATATAAGGCTGT

GCTTATGCTTTGTGTCTATCATCAAACTTTGCTCAGTGTTTACTTTTGTATTCAGGAGAAAGCAAGCACTTGAGGAGTTGGCAGAGCTGGGCATACCCAT

TTGCTTGCTTCATTCATTACTCAGGTTGGTGGGCTAGGTTTGGAAATCTATAGAGATTTTATTGCTAACTGCTGCCTTCATTAATCCCTATCATCCCCAC

CCTTCCAATCAAAGCCTATCTACTTTGTGACTTTAGAATTCTATTTTGAGGAGCATTTGTGAACTTGGCTTAGAGTTTGTAGACTTGCGTACTTGTTTCA

CTTGTGTCTGAGAGCTGTTAGCACTAGATTTGCCTCAGAATTAAGCAGGCAACTGTCACTGACTTCACTGCACTTCAGGGTGACCCTGCTTGATGTGTGG

CTCACAGAAGATTTGCCAAATTATACCATAGTGACAGTCTGCCCCTGCCCCCCATAGATTACTCTCCACCGCCACAAATCAGCACAAATAGCTAGGTTCT

TTCCTAGAGCTTCATTTTCATAACTTATCACCAAAAGAAATTGAACTCTGTCATTCTGGAAGCTCTTTTCCCTGGCTGAGAACAATAGAAAGTGCATACA

GTGTGAAGGTCTCACAAACATTTGCTAGGTTGTCCTTTCAATGCATGTGCAGGCTGCACCCTGTTGTTGTTTTAAGCCAGGGTTTATAAATAAGTAGATT

TATATCTGTCTTAATAGAAGTGTATATTTTATGCAAGAATTAAATGCTTTACAACATAAATTATGACTTGACCTCTCGTAAACTTCGGTGGCAATACGGA

TTGAATCCCGACAGTTGTCTTGTATTTGCTTCCTAGGTTTCTGCATGCGAGTGGTGATAGGTAGGACTGACAACACACTGCCTTTGACTTCTAGCACTTA

GCAGTCAAGAGTTGTAGAGTCAACAAAGCTGTAAGTCTCTTCACTTAACCTGTGGTTCTTCTAAAACTATTATCTAAATCTACAGCATCCCACCATGGAA

TACCTGGTAATTTATGTTGTGATGTGTTGCAGCATGTAAATAACTATAACTTCTCTGCAATAAAACATTTATATGAAAA
Translation
MGAMAYSLLFCLLLAHLGLGEVGASLDPPGRPDSPRERTPRGKQHGQQLPRASAPDPSIPWSRSTDGTILAQKLAEEVPVDVASYLYTGDFHQLKRANCS

GRYELAGLPGKSPSLASSHPSLHGALDTLTHATNFLNMMLQSNKSREQTVQDDLQWYQALVRSLLEGEPSISRAAITFSTESLSTPAPQVFLQATREESR

ILLQDLSSSAHHLANATLETEWFHGLRRKWRPHLHRRGSNQGPRGLGHSWRRRDGLGGDRSHVKWSPPYLECENGSYKPGWLVTLSAAFYGLQPNLVPEF

R RGVMKVDISLQKVDIDQCSSDGWFSGTHKCHLNNSE - UNI36863 - CMPIKGLGFVLGAYQCICKAGFYHPRVFSVNNFQR RRGPDHHFSGST

KDVSEETHVCLPCREGCPFCADDRPCFVQEDKYLRLAIISFQALCMLLDFVSMLVVYHFRKAK - UNI33750 - SIRASGLILLETILFGSLLLYFP

 VVILYFEPSTFRCILLRWARLLGFATVYGTVTLKLHR RVLKVFLSRTAQRIPYMTGGRVMRMLAVIVLVVFWFLVGWTSSMCQNLERDILLVGQGQTS

DHLTFNMCLIDRWDYMTAVA AEFLFLLWGIYLCYAVRTVPSAFHEPRYMAVAVHNELIITAIFHTIR RFVLASRLQPDWMLMLYFAHAHLTVTVTIGL

LLIPK FSHSSNNPRDDIATEAYEDELDMGRSGSYLNSSINSAWSEHSLDPEDIR DELKKLYAQLEIYKRKKMITNNPHLQKKRCSKKGLGRSIMRRIT

EIPETVSRQCSKEDKEGTDHSAAKGTGLVRKNPTESSGNTGRPKEESLKNRVFSLKKSHSTYDHVRDQTVESSSLPMESQEEEATENSTLESLSSKKLTQ

KLKEDSEAESTESVPLVCKSASAHNLSSEKKPGHPRTSMLQKSLSVIASAKEKTLGLAGKTQTLVMEDRAKSQKPKDRETIRKYSNSDNVETIPNSGHME

EPRKPQKSGIMKQQRVSLPTANPDVSSGITQIKDNFDIGEVCPWEVYDLTPGPMPSEPKAQKHVSIAASEVEQNPASFLKEKSYHKSKATEGLYQANHKS

IDKTEVCPWEIHSQSLLEDENRLISKTPVLPGRAREENGSQLYTTNMCAGQYEELPHKVVAPKVENENLNQMGDQEKQTSSSVDIIPGSCNSSNNSHQPL

TSRAEVCPWEFEPLEQPNAERSVTLPASSALSANKIPGPQK

For any suggestions or comments, please send an email to unitrap@crg.es