Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000045980 (Tmem104)
Chromosomal location
Chr 11: 115048801 - 115108337 (+)
Description
transmembrane protein 104 Gene [Source:MGI (curated);Acc:Tmem104-001]
RefSeq_dna
NM_001033393 
RefSeq_peptide
NP_001028565.1 
UniGene
Mm.260587 
MGI
MGI:2444222 
Uniprot/SWISSPROT
Q3TB48 
Uniprot/SPTREMBL
Q6KAU5 A2A6S0 B2RU54 A2A6S1 
Human Ortholog
ENSG00000109066 (TMEM104)
Omim not available
UniTrap UNI3039
Vector Insertion
Chr 11: 115049523 - 115049637
Public Clones AN0685 (sanger) XP0021 (sanger) XP0012 (sanger) RRN197 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000106555
Sequence
GGCGCTGGTGCGGGGCCGCTGGTGCCGGGTGGCAGCTGCAGAGCTGGAGGCGGTGGCCACTGTGCCTGGAAGCTAGCTGTGCTGCAG - UNI3039 - 

GAGCTGCGGCTGCTGCTGCCACTGCATAGAAGTAACCTCTTGGGCCAGCCCTTCCTCACTCTCTGGAGATGGCAGGCGAGATCACAGAGACCGGAGAGCT

CTATTCTCCTTAT - UNI3039 - GTCGGGCTGGTGTACATGTTTAACCTCATCGTGGGCACAGGTGCGCTCACCATGCCCAAGGCCTTTGCCACCGC

CGGGTGGCTCGTCAGCCTCGTTCTGCTGGTATTCGTAGGCTTCATGAG CTTTGTGACAACCACCTTTGCGATGGAAGCCATGGCTGCAGCCAATGCCCA

GCTCCGCTGGAAGAGGATGGAGACCCACAAG GAAGAGGATGACGAAGACTCGTCCACAGCCTCAGACAGTGACCTCCTCAGCCAAGACAACTACGAGAG

GGCAGAGAAACGCCCCATCCTGTCTGTGC AGAGACGCTCATCTGCCAACCTTTTTGAAATCACAGACCGGGTGGAAATGGGACAGATGGCTTCCATGTT

CTTCAATAAAG TGGGGGTCAACTTGTTCTATTTCTGCATCATTACTTACCTGTATGGAGACCTCGCCATCTACGCGGCCGCGGTGCCCGTGTCCCTCAT

GCAGGTGACCTG CAGCGTCTCTGGAAATGACTCTTGCGGCGTGGATACAGACGCCAGATACAACGACACTGAT GCCTTTGCCATCATGATTGTGCTGG

CCCTGGTGCGCATCGGGAAAGGACAAGGAGAGGGGCACCCGCCCCTAGCCAACTTCTTGGGGGTCCAGAACCTGTTTGGGGTGTGTGTCTACTCGTTCAT

GTGCCAACACTCCCTGCCGTCCCTCATCACTCCCATCTCCTCCAAGCGCCACATCACGCGGCTGCTGTTCCTGGACTACGCACTGATCCTGGCCTTCTAC

GGCCTCCTCTCCTTCACGGCTATCTTCTGCTTCCGTGGGGACAGCCTCATGGACATGTACACCCTCAACTTCGCGAGGTGTGACGTCGTGGGCCTTGCTG

CAGTCCGGTTCTTTCTGGGCCTCTTCCCTGTGTTCACCATCAGCACCAACTTCCCCATCATCGCGGTGACCCTGCGCAACAACTGGAAGACGCTCTTCCA

CCGTGAAGGTGGCACCTACCCATGGGTGGTAGACCGAGTGGTGTTCCCCACGATCACCCTGGTGCCTCCCATTCTGGTGGCCTTCTGCACCCATGACCTG

GAGTCCCTGGTGGCCATTACAGGAGCCTATGCGGGCACCGGCATCCAGTACGTCATCCCTGCCTTCCTGGTGTACCTCTGCCGCAAGGACACCCAGCTGA

CCTTTGGCTATGGAACTGTCAACAAGCATAGGTCCCCGTTCCGCCACACCTTCTGGGTGGCCTTTGTGCTGCTGTGGGCTTTCTCCTGCTTCTTCTTTGT

CACGGCCTACATCGTCCTCAAGGAGACCCAGCTCTGA
Translation
 - UNI3039 - PLGPALPHSLEMAGEITETGELYSPY - UNI3039 - VGLVYMFNLIVGTGALTMPKAFATAGWLVSLVLLVFVGFMS SFVTTT

FAMEAMAAANAQLRWKRMETHK EEDDEDSSTASDSDLLSQDNYERAEKRPILSVQ QRRSSANLFEITDRVEMGQMASMFFNKV VGVNLFYFCIITYL

YGDLAIYAAAVPVSLMQVTC CSVSGNDSCGVDTDARYNDTD AFAIMIVLALVRIGKGQGEGHPPLANFLGVQNLFGVCVYSFMCQHSLPSLITPISSK

RHITRLLFLDYALILAFYGLLSFTAIFCFRGDSLMDMYTLNFARCDVVGLAAVRFFLGLFPVFTISTNFPIIAVTLRNNWKTLFHREGGTYPWVVDRVVF

PTITLVPPILVAFCTHDLESLVAITGAYAGTGIQYVIPAFLVYLCRKDTQLTFGYGTVNKHRSPFRHTFWVAFVLLWAFSCFFFVTAYIVLKETQL
Transcript ENSMUST00000061450
Sequence
GGCGCTGGTGCGGGGCCGCTGGTGCCGGGTGGCAGCTGCAGAGCTGGAGGCGGTGGCCACTGTGCCTGGAAGCTAGCTGTGCTGCAG - UNI3039 - 

GAGCTGCGGCTGCTGCTGCCACTGCATAGAAGTAACCTCTTGGGCCAGCCCTTCCTCACTCTCTGGAGATGGCAGGCGAGATCACAGAGACCGGAGAGCT

CTATTCTCCTTAT - UNI3039 - GTCGGGCTGGTGTACATGTTTAACCTCATCGTGGGCACAGGTGCGCTCACCATGCCCAAGGCCTTTGCCACCGC

CGGGTGGCTCGTCAGCCTCGTTCTGCTGGTATTCGTAGGCTTCATGAG CTTTGTGACAACCACCTTTGCGATGGAAGCCATGGCTGCAGCCAATGCCCA

GCTCCGCTGGAAGAGGATGGAGACCCACAAG GAAGAGGATGACGAAGACTCGTCCACAGCCTCAGACAGTGACCTCCTCAGCCAAGACAACTACGAGAG

GGCAGAGAAACGCCCCATCCTGTCTGTGC AGAGACGCTCATCTGCCAACCTTTTTGAAATCACAGACCGGGTGGAAATGGGACAGATGGCTTCCATGTT

CTTCAATAAAG TGGGGGTCAACTTGTTCTATTTCTGCATCATTACTTACCTGTATGGAGACCTCGCCATCTACGCGGCCGCGGTGCCCGTGTCCCTCAT

GCAGGTGACCTG CAGCGTCTCTGGAAATGACTCTTGCGGCGTGGATACAGACGCCAGATACAACGACACTGATCTGTGCTGGGGCCCCCTGCGCCGGGT

GGATGTCTACCGAATCTATCTG GCCATCTTCACCGTCCTTCTTGGCCCGTTCACCTTCTTTGATGTCCAGAAGACTAAGTACCTGCAGATCTTGACCTC

TATGATGAGATGGATCG CCTTTGCCATCATGATTGTGCTGGCCCTGGTGCGCATCGGGAAAGGACAAGGAGAGGGGCACCCGCCCCTAGCCAACTTCTT

GGGGGTCCAGAACCTGTTTGGGGTGTGTGTCTACTCGTTCATGTGCCAACACTCCCTGCCGTCCCTCATCACTCCCATCTCCTCCAAGCGCCACATCACG

CGGCTGCTGTTCCTGGACTACGCACTGATCCTGGCCTTCTACGGCCTCCTCTCCTTCACGGCTATCTTCTGCTTCCGTGGGGACAGCCTCATGGACATGT

ACACCCTCAACTTCGCGAGGTGTGACGTCGTGGGCCTTGCTGCAGTCCGGTTCTTTCTGGGCCTCTTCCCTGTGTTCACCATCAGCACCAACTTCCCCAT

CATCGCGGTGACCCTGCGCAACAACTGGAAGACGCTCTTCCACCGTGAAGGTGGCACCTACCCATGGGTGGTAGACCGAGTGGTGTTCCCCACGATCACC

CTGGTGCCTCCCATTCTGGTGGCCTTCTGCACCCATGACCTGGAGTCCCTGGTGGCCATTACAGGAGCCTATGCGGGCACCGGCATCCAGTACGTCATCC

CTGCCTTCCTGGTGTACCTCTGCCGCAAGGACACCCAGCTGACCTTTGGCTATGGAACTGTCAACAAGCATAGGTCCCCGTTCCGCCACACCTTCTGGGT

GGCCTTTGTGCTGCTGTGGGCTTTCTCCTGCTTCTTCTTTGTCACGGCCTACATCGTCCTCAAGGAGACCCAGCTCTGATAGCAGATGTGTCTGACAACA

GGAGGCAGAAACAGCCCAGCTCCAGCCTCCCTGCATCAAAGCAGGATTTAGCTGCCACCCGGGTCTACGTGAGCATGCTAGGCTGGGGCTCTCGGAGAAG

GCCTTCTACGTCTCCAGCTGCTGACTTCTCCCCACCCAGGACGTCACCATGCAGGACAGCTCTCCTGCACGGGAACATGGCTGTCACACACATTCCTCCA

CTCCTGCCACTGGAGGCTGGCTCCCTCCTCCGCAGTGGAGGAGACAGTGCTGACCCTGCTGCTATTTATATTAGACCCCGTGCCCCCTACCGCATCCTCA

ACCATCCACTAGCAGTGGCTGCCTCCTCAAAGGTGAATTCCAGTCCCTGGCTCTCCTAACCTGACCTGCTTGGAAGGGCAAGGCCCTCTTCCCTGCCAAT

CCTGACAGTTGCTAAGTTGTTTTTACCCCCTATGGGTGGCCCAGCCAGCTCTAGTGACAAGGACAGGAAGTGCTAATTGGCACCAGGGTCTCTAGGCAAG

AGCCTGCGAGAGTGTCTGGCTCTGGCAACAGCAGACAGATGAAGCATCCTTCCCCAGGGTTTAGAGCCCTTTGCTTGGGTCCCTGAGAGGAGTCCTATGT

CCCCTGGCTTCTCCTTTGGAGCCCAGGGACCCCCTGAATTGCGGGGTACCACTTGAAAAGCTGCCCTCATCACCCCCACACACACACACACTCACACACC

CATTGTAGCTGACCACCCTGGACTTACAACAGGGAGAGCACAGAGTGACTCTCTGCAAAAGGTCAGGCTGGTGTCAGGCAGCCCAGCTTGCAGCCAGGCT

GCATTGCAACACTAAGGTGGTGCCCTTTGGAGCCTGGTCATGGGTGCTCAGTGGCCACCCTCTCCAGGTCCCTGGCTACCGTGGAGCTGGAGGGGGTGCA

TACCACCATTCCTGTGGAAGGAGGCCGGGCTCCCAGCTGCCTCCTGTTGGGTCACGCCTGCGCGCACTAGGCCCGATGCCTTGGAATGATGAGTGAGTGA

TGAACTGCATTTTCGATGTGCCTTCTGCTTTGAGCACCAGTGATCCCTCCTGACCCTGACTTGCCCCAGCCCTGGGCCTAGTCCCGCCTCTCCTGGACAG

AACTGCCTCTGGGGTGGAGGGTCCTAGACCCCTGCCCCCTCCCTCTTGATTTCAGTGCCTTGCTCCACCCTCGTGAGGGAACTTGCGCCAGCCACCTCTT

CCCTTTCTACATCTTGCCCGCCATATTTAAAGCTCGAACTCTGCTGTGTTGTTGGATGTCCCAGGACCCAGGAGGCTGTGCAGAACCTGCCAAGAATGTG

GGACCCACTGGCAGCACCTGCCACCTCTGGTCCCAGCATCCCTGCCCCTACGCATCTCCAGATGGAGGTGGGCCAGGCTGCAGCTTCTTACAGCTGTCCC

ACATCAATAGTTCCAGCCACACGGAAGACAGACGTCCCTATGCTGGTCTGCCAGTGCAGCATCTTCCCAGGAAGCCCTGTCCCACAGTGCGCCAAGTAAG

GAAAGCAATACAGTAGCAGGCGCAGGAGTAAGGGACAGCTGCCCATCATCCCTGCCCCGCCCCGCCCCCGTCTCAGGCTGTTTGCTGAGAACTCAATTAA

AACATCTGTACTTAACCTTCTCCCTCTTGCTTAAGGACAAAGCAAATTAAATCTTCCCACTGCAACACACACACCTCACCCCACCCCCAGGCTCCAAACT

GAATTTTGGTGGAAAATTTATTAGCATCATAAAGCCCAAGTTGATTTATGTGACAATCTGGAGCCACACACAGCGGCTGCTGCGCTCCCCACCCCCAAGT

TAAGTTAGGGAAGCCCCAGCCTGGGCAGGAGGAGGGACGGGCTGGCCACATCACTGATGCCAAGCCAACCTCCCCACTGTCTGGTTTCTGTGCTCCTTCA

TCTCCACCTATTGTCTGACCTGCTAGAAGCCACATGAGGTCTTATCACACCAGGCCTCTGTCACTGGTAGCCAGGAGTGTTGGGCACAGAGAGGAGAGGA

CTGGGGGTGGGGGTAGCATTTGTGGGTATCATTTGTTGTCACCCCCTCCCACACACACACAGGCATCGAGCACACTAAATATTTGTATATCACCTGGGTA

AGGTGATACGTTAGGTCATGGCATCTGCATAGAGGCCCTGGGGTTCGTGGTCCAGAGGACAGCAAGGAGCCCACCCAGCCTGGCCCCAGATCCGAGTCTC

TGAAACTCAGCCATTGTCACTGCCATCTTTCTGCCTTGCCCCGGACCCGTCCCGAGGGCAGGGCAGGTCAAGGTGGGAACGATCATTCTCTAGAGCTCCA

GACCCAGCTGAGCATCCACACGGTGCCAGGAGCTCTGGCTGTGCCTCACCTGAGGCTGGTAGATGGGGCAGATGGCAGGTGTCAGGCTGTGAGGCACTGC

GGAGCGGTAAAAAGTGGCATTGGGCACCAGGCCAGGCCCAAAGCCACACAGCTGTCCTCACCACATGGGGCCAAGAGCCTCAGCAACAGGCAGTGGCTGT

CTCTTGGGGCTCCAGCTGAAGAGAAGTAGCTGGTGGTTCCAGACCCAGGGGCAGAGGAAGGCTGCCGGTCTAAGGAGTAAAGTGCCAAGCAAGTGAAGTG

CAGGGGCTGCTGAAAGCTGACTGTGACAGCCAGGTGGCGGCAAGCCCTGTCAACCTTCCTCCTGGGGGGCGGGGGGTGGGGGAGTGGATGGATATGCTGT

GTGCCTGGTACATTGTGAGGACCAAACTGTCATAACCCCCATACCCCGTGGCCTCTAAGCAGCAAGCATCTATAACCCTCCCTCTTGTGGGGACCTCCAG

ATCGTAGGTCGTGGAAACTAAAGGACTGAGCTTATCCCAGCACCAAAGTCCTTAATAAAGCTGCTATTACCC
Translation
 - UNI3039 - MAGEITETGELYSPY - UNI3039 - VGLVYMFNLIVGTGALTMPKAFATAGWLVSLVLLVFVGFMS SFVTTTFAMEAMAAANA

QLRWKRMETHK EEDDEDSSTASDSDLLSQDNYERAEKRPILSVQ QRRSSANLFEITDRVEMGQMASMFFNKV VGVNLFYFCIITYLYGDLAIYAAAV

PVSLMQVTC CSVSGNDSCGVDTDARYNDTDLCWGPLRRVDVYRIYL AIFTVLLGPFTFFDVQKTKYLQILTSMMRWIA AFAIMIVLALVRIGKGQGE

GHPPLANFLGVQNLFGVCVYSFMCQHSLPSLITPISSKRHITRLLFLDYALILAFYGLLSFTAIFCFRGDSLMDMYTLNFARCDVVGLAAVRFFLGLFPV

FTISTNFPIIAVTLRNNWKTLFHREGGTYPWVVDRVVFPTITLVPPILVAFCTHDLESLVAITGAYAGTGIQYVIPAFLVYLCRKDTQLTFGYGTVNKHR

SPFRHTFWVAFVLLWAFSCFFFVTAYIVLKETQL
Transcript ENSMUST00000100235
Sequence
GGGAAGCGTGCGCGTGCGCGTAGCGGGCGCTGGTGCGGGGCCGCTGGTGCCGGGTGGCAGCTGCAGAGCTGGAGGCGGTGGCCACTGTGCCTGGAAGCTA

GCTGTGCTGCAG - UNI3039 - GAGCTGCGGCTGCTGCTGCCACTGCATAGAAGTAACCTCTTGGGCCAGCCCTTCCTCACTCTCTGGAGATGGCAG

GCGAGATCACAGAGACCGGAGAGCTCTATTCTCCTTAT - UNI3039 - GTCGGGCTGGTGTACATGTTTAACCTCATCGTGGGCACAGGTGCGCTCA

CCATGCCCAAGGCCTTTGCCACCGCCGGGTGGCTCGTCAGCCTCGTTCTGCTGGTATTCGTAGGCTTCATGAG CTTTGTGACAACCACCTTTGCGATGG

AAGCCATGGCTGCAGCCAATGCCCAGCTCCGCTGGAAGAGGATGGAGACCCACAAG GAAGAGGATGACGAAGACTCGTCCACAGCCTCAGACAGTGACC

TCCTCAGCCAAGACAACTACGAGAGGGCAGAGAAACGCCCCATCCTGTCTGTGC AGAGACGCTCATCTGCCAACCTTTTTGAAATCACAGACCGGGTGG

AAATGGGACAGATGGCTTCCATGTTCTTCAATAAAG TGGGGGTCAACTTGTTCTATTTCTGCATCATTACTTACCTGTATGGAGACCTCGCCATCTACG

CGGCCGCGGTGCCCGTGTCCCTCATGCAGGTGACCTG CGTCTCTGGAAATGACTCTTGCGGCGTGGATACAGACGCCAGATACAACGACACTGATCTGT

GCTGGGGCCCCCTGCGCCGGGTGGATGTCTACCGAATCTATCTG GCCATCTTCACCGTCCTTCTTGGCCCGTTCACCTTCTTTGATGTCCAGAAGACTA

AGTACCTGCAGATCTTGACCTCTATGATGAGATGGATCG CCTTTGCCATCATGATTGTGCTGGCCCTGGTGCGCATCGGGAAAGGACAAGGAGAGGGGC

ACCCGCCCCTAGCCAACTTCTTGGGGGTCCAGAACCTGTTTGGGGTGTGTGTCTACTCGTTCATGTGCCAACACTCCCTGCCGTCCCTCATCACTCCCAT

CTCCTCCAAGCGCCACATCACGCGGCTGCTGTTCCTGGACTACGCACTGATCCTGGCCTTCTACGGCCTCCTCTCCTTCACGGCTATCTTCTGCTTCCGT

GGGGACAGCCTCATGGACATGTACACCCTCAACTTCGCGAGGTGTGACGTCGTGGGCCTTGCTGCAGTCCGGTTCTTTCTGGGCCTCTTCCCTGTGTTCA

CCATCAGCACCAACTTCCCCATCATCGCGGTGACCCTGCGCAACAACTGGAAGACGCTCTTCCACCGTGAAGGTGGCACCTACCCATGGGTGGTAGACCG

AGTGGTGTTCCCCACGATCACCCTGGTGCCTCCCATTCTGGTGGCCTTCTGCACCCATGACCTGGAGTCCCTGGTGGCCATTACAGGAGCCTATGCGGGC

ACCGGCATCCAGTACGTCATCCCTGCCTTCCTGGTGTACCTCTGCCGCAAGGACACCCAGCTGACCTTTGGCTATGGAACTGTCAACAAGCATAGGTCCC

CGTTCCGCCACACCTTCTGGGTGGCCTTTGTGCTGCTGTGGGCTTTCTCCTGCTTCTTCTTTGTCACGGCCTACATCGTCCTCAAGGAGACCCAGCTCTG

ATAGCAGATGTGTCTGACAACAGGAGGCAGAAACAGCCCAGCTCCAGCCTCCCTGCATCAAAGCAGGATTTAGCTGCCACCCGGGTCTACGTGAGCATGC

TAGGCTGGGGCTCTCGGAGAAGGCCTTCTACGTCTCCAGCTGCTGACTTCTCCCCACCCAGGACGTCACCATGCAGGACAGCTCTCCTGCACGGGAACAT

GGCTGTCACACACATTCCTCCACTCCTGCCACTGGAGGCTGGCTCCCTCCTCCGCAGTGGAGGAGACAGTGCTGACCCTGCTGCTATTTATATTAGACCC

CGTGCCCCCTACCGCATCCTCAACCATCCACTAGCAGTGGCTGCCTCCTCAAAGGTGAATTCCAGTCCCTGGCTCTCCTAACCTGACCTGCTTGGAAGGG

CAAGGCCCTCTTCCCTGCCAATCCTGACAGTTGCTAAGTTGTTTTTACCCCCTATGGGTGGCCCAGCCAGCTCTAGTGACAAGGACAGGAAGTGCTAATT

GGCACCAGGGTCTCTAGGCAAGAGCCTGCGAGAGTGTCTGGCTCTGGCAACAGCAGACAGATGAAGCATCCTTCCCCAGGGTTTAGAGCCCTTTGCTTGG

GTCCCTGAGAGGAGTCCTATGTCCCCTGGCTTCTCCTTTGGAGCCCAGGGACCCCCTGAATTGCGGGGTACCACTTGAAAAGCTGCCCTCATCACCCCCA

CACACACACACACTCACACACCCATTGTAGCTGACCACCCTGGACTTACAACAGGGAGAGCACAGAGTGACTCTCTGCAAAAGGTCAGGCTGGTGTCAGG

CAGCCCAGCTTGCAGCCAGGCTGCATTGCAACACTAAGGTGGTGCCCTTTGGAGCCTGGTCATGGGTGCTCAGTGGCCACCCTCTCCAGGTCCCTGGCTA

CCGTGGAGCTGGAGGGGGTGCATACCACCATTCCTGTGGAAGGAGGCCGGGCTCCCAGCTGCCTCCTGTTGGGTCACGCCTGCGCGCACTAGGCCCGATG

CCTTGGAATGATGAGTGAGTGATGAACTGCATTTTCGATGTGCCTTCTGCTTTGAGCACCAGTGATCCCTCCTGACCCTGACTTGCCCCAGCCCTGGGCC

TAGTCCCGCCTCTCCTGGACAGAACTGCCTCTGGGGTGGAGGGTCCTAGACCCCTGCCCCCTCCCTCTTGATTTCAGTGCCTTGCTCCACCCTCGTGAGG

GAACTTGCGCCAGCCACCTCTTCCCTTTCTACATCTTGCCCGCCATATTTAAAGCTCGAACTCTGCTGTGTTGTTGGATGTCCCAGGACCCAGGAGGCTG

TGCAGAACCTGCCAAGAATGTGGGACCCACTGGCAGCACCTGCCACCTCTGGTCCCAGCATCCCTGCCCCTACGCATCTCCAGATGGAGGTGGGCCAGGC

TGCAGCTTCTTACAGCTGTCCCACATCAATAGTTCCAGCCACACGGAAGACAGACGTCCCTATGCTGGTCTGCCAGTGCAGCATCTTCCCAGGAAGCCCT

GTCCCACAGTGCGCCAAGTAAGGAAAGCAATACAGTAGCAGGCGCAGGAGTAAGGGACAGCTGCCCATCATCCCTGCCCCGCCCCGCCCCCGTCTCAGGC

TGTTTGCTGAGAACTCAATTAAAACATCTGTACTTAACCTTCTCCCTCTTGCTTAAGGACAAAGCAAATTAAATCTTCCCACTGCAACACACACACCTCA

CCCCACCCCCAGGCTCCAAACTGAATTTTGGTGGAAAATTTATTAGCATCATAAAGCCCAAGTTGATTTATGTGACAATCTGGAGCCACACACAGCGGCT

GCTGCGCTCCCCACCCCCAAGTTAAGTTAGGGAAGCCCCAGCCTGGGCAGGAGGAGGGACGGGCTGGCCACATCACTGATGCCAAGCCAACCTCCCCACT

GTCTGGTTTCTGTGCTCCTTCATCTCCACCTATTGTCTGACCTGCTAGAAGCCACATGAGGTCTTATCACACCAGGCCTCTGTCACTGGTAGCCAGGAGT

GTTGGGCACAGAGAGGAGAGGACTGGGGGTGGGGGTAGCATTTGTGGGTATCATTTGTTGTCACCCCCTCCCACACACACACAGGCATCGAGCACACTAA

ATATTTGTATATCACCTGGGTAAGGTGATACGTTAGGTCATGGCATCTGCATAGAGGCCCTGGGGTTCGTGGTCCAGAGGACAGCAAGGAGCCCACCCAG

CCTGGCCCCAGATCCGAGTCTCTGAAACTCAGCCATTGTCACTGCCATCTTTCTGCCTTGCCCCGGACCCGTCCCGAGGGCAGGGCAGGTCAAGGTGGGA

ACGATCATTCTCTAGAGCTCCAGACCCAGCTGAGCATCCACACGGTGCCAGGAGCTCTGGCTGTGCCTCACCTGAGGCTGGTAGATGGGGCAGATGGCAG

GTGTCAGGCTGTGAGGCACTGCGGAGCGGTAAAAAGTGGCATTGGGCACCAGGCCAGGCCCAAAGCCACACAGCTGTCCTCACCACATGGGGCCAAGAGC

CTCAGCAACAGGCAGTGGCTGTCTCTTGGGGCTCCAGCTGAAGAGAAGTAGCTGGTGGTTCCAGACCCAGGGGCAGAGGAAGGCTGCCGGTCTAAGGAGT

AAAGTGCCAAGCAAGTGAAGTGCAGGGGCTGCTGAAAGCTGACTGTGACAGCCAGGTGGCGGCAAGCCCTGTCAACCTTCCTCCTGGGGGGCGGGGGGTG

GGGGAGTGGATGGATATGCTGTGTGCCTGGTACATTGTGAGGACCAAACTGTCATAACCCCCATACCCCGTGGCCTCTAAGCAGCAAGCATCTATAACCC

TCCCTCTTGTGGGGACCTCCAGATCGTAGGTCGTGGAAACTAAAGGACTGAGCTTATCCCAGCACCAAAGTCCTTAATAAAGCTGCTATTACCC
Translation
 - UNI3039 - MAGEITETGELYSPY - UNI3039 - VGLVYMFNLIVGTGALTMPKAFATAGWLVSLVLLVFVGFMS SFVTTTFAMEAMAAANA

QLRWKRMETHK EEDDEDSSTASDSDLLSQDNYERAEKRPILSVQ QRRSSANLFEITDRVEMGQMASMFFNKV VGVNLFYFCIITYLYGDLAIYAAAV

PVSLMQVTC CVSGNDSCGVDTDARYNDTDLCWGPLRRVDVYRIYL AIFTVLLGPFTFFDVQKTKYLQILTSMMRWIA AFAIMIVLALVRIGKGQGEG

HPPLANFLGVQNLFGVCVYSFMCQHSLPSLITPISSKRHITRLLFLDYALILAFYGLLSFTAIFCFRGDSLMDMYTLNFARCDVVGLAAVRFFLGLFPVF

TISTNFPIIAVTLRNNWKTLFHREGGTYPWVVDRVVFPTITLVPPILVAFCTHDLESLVAITGAYAGTGIQYVIPAFLVYLCRKDTQLTFGYGTVNKHRS

PFRHTFWVAFVLLWAFSCFFFVTAYIVLKETQL

For any suggestions or comments, please send an email to unitrap@crg.es