Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000046110 (Serinc4)
Chromosomal location
Chr 2: 121276916 - 121282517 (-)
Description
serine incorporator 4 Gene [Source:MGI (curated);Acc:Serinc4-001]
RefSeq_dna
NM_001025371 
RefSeq_peptide
NP_001020542.1 
UniGene
Mm.459165 
MGI
MGI:2441842 
Uniprot/SWISSPROT
Q5XK03 
Uniprot/SPTREMBL
A2ARQ6 
Human Ortholog
ENSG00000184716 (SERINC4)
Omim not available
UniTrap UNI22760
Vector Insertion
Chr 2: 121281510 - 121281578
Public Clones not available
Private Clones OST285379 (lexicon)
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6492
Vector Insertion
Chr 2: 121278367 - 121278417
Public Clones CSC069 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38249
Vector Insertion
Chr 2: 121278367 - 121278905
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110613
Sequence
AGAATAACAGTCCGAATGATCCCGAATAGGAAGCCCGGCGAAGGCATCTTCACAAGACTATTTGCATCTATCTACCACTTCCTGGTAACCTGTATTCATT

TTATGACATGTCTATGCTGCCTTAAGACGAATGATTAGGCCAGCAAAGCGACTGTCCAATGGGCGAAAATCCCGAGAAGCTGCTGTTTCTCGTCAGTTTT

TCCAATACTGGATCTACATCTAACAAAAATGATGGGTGCAAAAGTTGTCACCGGCCGGAGCACCACCCAGGGTCTTGCACAGCAGCACGGTGGAGTCAGT

AATGTAGTGGAAACCCCCTTCAATCAG GCATCCTGCTGTGGACCTGTTTCTTGGACCAGTGGCTGCCACTCTCTGACAGAGTCTAGGTGTAGCCGCCTG

CTCTACATCCTCCTCCACGTGGGAGCCTCAGCAATCTGCTGCCTCCTGCTTTCGAAGACAGTGGTAGAAAGGGTCTGGGGCAAAGCACATGGG - UNI2

2760 - ATCCAGATGCCCTCAGTGCTATGTGCCCACCTGTTTGGCAGCTCGGACTGCCCAGTTCTCAGTGGCTCTGGCGCTGTGTATCGAGTGTGTGCA

GGAACTGCCACCTTCCACCTGCTGCAGGCTGTGCTGCTAGTTCGCCTCCACTCCCCCACCAACCCTCGGGCACAGCTGCATAACAG CTTCTGGAGCCTC

AAGCTGTTGTTCCTGTTAGGTCTCTGTGTCGTTGCCTTCTGCATCCCTGATGAGGATCTCTTCCCAG CCTGGCATTATATTGGCATCTGTGGAGGCTTC

ACATTCATCCTATTACAGCTGGTGCTTATCACAGCCTTTGCCCAGTCCTGGAACAAGAATTG GCAGACTGGTGCAGCTCAAGACTGTAGCTGGCTCCTA

GGTGTGTCACTGGCCACACTAGGGTTCTACAGCATGGCGGGTGTGGGAGCTGTGTTGCTGTTCCACCAGTACACACACCCTGACGGTTGCCTGCTCAACA

AGATGTTACTCAGTCTGCACCTTTGCTTCTGTGGCCTCCTGTCTCTCCTCTCCATCGCACCTTGCATCCGCCGCA CAACGAGGCTTCCTACCTGGCCGA

GTTATTTGGACCCTTGTGGATTATCAAGGTTTACAAGTATGAGTTCCAG - UNI6492 - AAGCCCTCAGTCTGTTTCTGCTGCCCCCAAACAGTGGA

GCCAGAGGATG - UNI6492 - GGCAAAGGAGCAGGGCCAGGTCAGCTGACCAAGAGACCCCTCCAGCTGCTCAGGTGCAGAGCCAGCATCTTTCCTA

CAGCTACTCTGGCTTCCACTTCGCCTTCTTCCTTGCTTCACTCTATGTCATGGTTACCCTTACCAACTGGTTCAG CTATGAGGAAGCAGAACTGGAGAA

GACCTTCACTAAGGGTAGCTGGGCTACCTTCTGGGTTAAAGTTGCCTCATGCTGGGCCTGTGTCCTCCTCTATCTGGGGCTGCTCCTGGCACCACTGCTG

GCTCCCCACTCAGAATCACCACCACCCTAGTATATTCAGGCAACACTGCCATGGCATCAGTACTGCCACATAAAAACTGGCTCTTGATCTGTAGTAACAA

ACTGGGAGACAGACCCTTTAGATTATGCTCTTAATCTTAGCTCCAGGAACACCCAGCTGAACTCAATACCTCAAGGACAAATGAGCAGTTATCGGTGCAT

AGGCTCAGTAAGTATCTAAATTTGAAGAAGCAGACAAACTCACTAGTTCATTAAAGCTCAAGAGTCTAACTCCCAGGAAGTAAACCCAGGAGCCTTACCT

GATCCTAGCAGTGTGGCACAAGACCCTTTCTGGTTCCAGGGCTGGAGATAAGGTCAGGGAAAGACCTACAGAGATTGAAGATTTGGGTCTGCTCTTAGCA

ATCAAAAGGAAATGAGTAGCTCAGCCCTAAGCAGTGGTGGAAGAAGCCCAGACCACAGAACAAACCAGGGCAGGGGAAGAAGGGAGCAGAGGCTACCATA

GGTTTTAATCCTGGTCTTGAGGTCAAAGGAAATGGAAGACAAAAACCACCTTCATTCCATGAGGATTGACAGAACAGAAGAGAATGTGAGCATCCAGAGT

GGCTGACCACCAGAAGTTGGTGAGCAGCAGGATTTTTTTTTTTGGCCAACTTTCAAGCAAACAAAGAATGAAGAGACATAAATTTGGGTCTTAGATCCTT

CCCTCTTATGACCCTCAATACCATCCTGGGGATGGTGTCCAAGGTCGGTGTGGGGGATAAAAATCACAGAAAAGAAGTCTCTATAGTTCTTAGAGGACTC

CTCTGCCATATAACTGGAGTGCTTTTCCGGTTGCAATAGTTAAAATAAAGGCTTCTTCTGTGATGTTTTCC
Translation
MMGAKVVTGRSTTQGLAQQHGGVSNVVETPFNQ ASCCGPVSWTSGCHSLTESRCSRLLYILLHVGASAICCLLLSKTVVERVWGKAHG - UNI22760

 - IQMPSVLCAHLFGSSDCPVLSGSGAVYRVCAGTATFHLLQAVLLVRLHSPTNPRAQLHNS SFWSLKLLFLLGLCVVAFCIPDEDLFPA AWHYIGI

CGGFTFILLQLVLITAFAQSWNKNW WQTGAAQDCSWLLGVSLATLGFYSMAGVGAVLLFHQYTHPDGCLLNKMLLSLHLCFCGLLSLLSIAPCIRRT T

TRLPTWPSYLDPCGLSRFTSMSSR - UNI6492 - RSPQSVSAAPKQWSQRM - UNI6492 - GKGAGPGQLTKRPLQLLRCRASIFPTATLASTS

PSSLLHSMSWLPLPTGSA AMRKQNWRRPSLRVAGLPSGLKLPHAGPVSSSIWGCSWHHCWLPTQNHHHPSIFRQHCHGISTAT
Transcript ENSMUST00000056312
Sequence
AGAATAACAGTCCGAATGATCCCGAATAGGAAGCCCGGCGAAGGCATCTTCACAAGACTATTTGCATCTATCTACCACTTCCTGGTAACCTGTATTCATT

TTATGACATGTCTATGCTGCCTTAAGACGAATGATTAGGCCAGCAAAGCGACTGTCCAATGGGCGAAAATCCCGAGAAGCTGCTGTTTCTCGTCAGTTTT

TCCAATACTGGATCTACATCTAACAAAAATGATGGGTGCAAAAGTTGTCACCGGCCGGAGCACCACCCAGGGTCTTGCACAGCAGCACGGTGGAGTCAGT

AATGTAGTGGAAACCCCCTTCAATCAG GCATCCTGCTGTGGACCTGTTTCTTGGACCAGTGGCTGCCACTCTCTGACAGAGTCTAGGTGTAGCCGCCTG

CTCTACATCCTCCTCCACGTGGGAGCCTCAGCAATCTGCTGCCTCCTGCTTTCGAAGACAGTGGTAGAAAGGGTCTGGGGCAAAGCACATGGG - UNI2

2760 - ATCCAGATGCCCTCAGTGCTATGTGCCCACCTGTTTGGCAGCTCGGACTGCCCAGTTCTCAGTGGCTCTGGCGCTGTGTATCGAGTGTGTGCA

GGAACTGCCACCTTCCACCTGCTGCAGGCTGTGCTGCTAGTTCGCCTCCACTCCCCCACCAACCCTCGGGCACAGCTGCATAACAG CTTCTGGAGCCTC

AAGCTGTTGTTCCTGTTAGGTCTCTGTGTCGTTGCCTTCTGCATCCCTGATGAGGATCTCTTCCCAG CCTGGCATTATATTGGCATCTGTGGAGGCTTC

ACATTCATCCTATTACAGCTGGTGCTTATCACAGCCTTTGCCCAGTCCTGGAACAAGAATTG GCAGACTGGTGCAGCTCAAGACTGTAGCTGGCTCCTA

GGTGTGTCACTGGCCACACTAGGGTTCTACAGCATGGCGGGTGTGGGAGCTGTGTTGCTGTTCCACCAGTACACACACCCTGACGGTTGCCTGCTCAACA

AGATGTTACTCAGTCTGCACCTTTGCTTCTGTGGCCTCCTGTCTCTCCTCTCCATCGCACCTTGCATCCGCCGCA AGCAACCAAACTCTGGCCTCCTAC

AAGCCTCTATCATCAGCTGCTATATCATGTATCTGACCTTCTCTGCACTGTCCAGCCGTCCCCCAGAGACAA TAACCTTTCAAGGACAGAATCACACCT

TGTGTCTGCCTGGCCGGAATAAAATGGAACCACAAATACCGGATACCTCAGTAGCAGTGTTTAGTGCTGGCATCATGTATGCTTGTGTGCTCTTTGCTTG

 CAACGAGGCTTCCTACCTGGCCGAGTTATTTGGACCCTTGTGGATTATCAAGGTTTACAAGTATGAGTTCCAG - UNI6492 - AAGCCCTCAGTCT

GTTTCTGCTGCCCCCAAACAGTGGAGCCAGAGGATG - UNI6492 - GGCAAAGGAGCAGGGCCAGGTCAGCTGACCAAGAGACCCCTCCAGCTGCTC

AGGTGCAGAGCCAGCATCTTTCCTACAGCTACTCTGGCTTCCACTTCGCCTTCTTCCTTGCTTCACTCTATGTCATGGTTACCCTTACCAACTGGTTCAG

 CTATGAGGAAGCAGAACTGGAGAAGACCTTCACTAAGGGTAGCTGGGCTACCTTCTGGGTTAAAGTTGCCTCATGCTGGGCCTGTGTCCTCCTCTATCT

GGGGCTGCTCCTGGCACCACTGCTGGCTCCCCACTCAGAATCACCACCACCCTAGTATATTCAGGCAACACTGCCATGGCATCAGTACTGCCACATAAAA

ACTGGCTCTTGATCTGTAGTAACAAACTGGGAGACAGACCCTTTAGATTATGCTCTTAATCTTAGCTCCAGGAACACCCAGCTGAACTCAATACCTCAAG

GACAAATGAGCAGTTATCGGTGCATAGGCTCAGTAAGTATCTAAATTTGAAGAAGCAGACAAACTCACTAGTTCATTAAAGCTCAAGAGTCTAACTCCCA

GGAAGTAAACCCAGGAGCCTTACCTGATCCTAGCAGTGTGGCACAAGACCCTTTCTGGTTCCAGGGCTGGAGATAAGGTCAGGGAAAGACCTACAGAGAT

TGAAGATTTGGGTCTGCTCTTAGCAATCAAAAGGAAATGAGTAGCTCAGCCCTAAGCAGTGGTGGAAGAAGCCCAGACCACAGAACAAACCAGGGCAGGG

GAAGAAGGGAGCAGAGGCTACCATAGGTTTTAATCCTGGTCTTGAGGTCAAAGGAAATGGAAGACAAAAACCACCTTCATTCCATGAGGATTGACAGAAC

AGAAGAGAATGTGAGCATCCAGAGTGGCTGACCACCAGAAGTTGGTGAGCAGCAGGATTTTTTTTTTTGGCCAACTTTCAAGCAAACAAAGAATGAAGAG

ACATAAATTTGGGTCTTAGATCCTTCCCTCTTATGACCCTCAATACCATCCTGGGGATGGTGTCCAAGGTCGGTGTGGGGGATAAAAATCACAGAAAAGA

AGTCTCTATAGTTCTTAGAGGACTCCTCTGCCATATAACTGGAGTGCTTTTCCGGTTGCAATAGTTAAAATAAAGGCTTCTTCTGTGATGTTTTCC
Translation
MMGAKVVTGRSTTQGLAQQHGGVSNVVETPFNQ ASCCGPVSWTSGCHSLTESRCSRLLYILLHVGASAICCLLLSKTVVERVWGKAHG - UNI22760

 - IQMPSVLCAHLFGSSDCPVLSGSGAVYRVCAGTATFHLLQAVLLVRLHSPTNPRAQLHNS SFWSLKLLFLLGLCVVAFCIPDEDLFPA AWHYIGI

CGGFTFILLQLVLITAFAQSWNKNW WQTGAAQDCSWLLGVSLATLGFYSMAGVGAVLLFHQYTHPDGCLLNKMLLSLHLCFCGLLSLLSIAPCIRRK K

QPNSGLLQASIISCYIMYLTFSALSSRPPETI ITFQGQNHTLCLPGRNKMEPQIPDTSVAVFSAGIMYACVLFAC CNEASYLAELFGPLWIIKVYKYE

FQ - UNI6492 - KPSVCFCCPQTVEPEDG - UNI6492 - GQRSRARSADQETPPAAQVQSQHLSYSYSGFHFAFFLASLYVMVTLTNWFS SYE

EAELEKTFTKGSWATFWVKVASCWACVLLYLGLLLAPLLAPHSESPPP
Transcript ENSMUST00000067823
Sequence
AGAATAACAGTCCGAATGATCCCGAATAGGAAGCCCGGCGAAGGCATCTTCACAAGACTATTTGCATCTATCTACCACTTCCTGGTAACCTGTATTCATT

TTATGACATGTCTATGCTGCCTTAAGACGAATGATTAGGCCAGCAAAGCGACTGTCCAATGGGCGAAAATCCCGAGAAGCTGCTGTTTCTCGTCAGTTTT

TCCAATACTGGATCTACATCTAACAAAAATGATGGGTGCAAAAGTTGTCACCGGCCGGAGCACCACCCAGGGTCTTGCACAGCAGCACGGTGGAGTCAGT

AATGTAGTGGAAACCCCCTTCAATCAG GCATCCTGCTGTGGACCTGTTTCTTGGACCAGTGGCTGCCACTCTCTGACAGAGTCTAGGTGTAGCCGCCTG

CTCTACATCCTCCTCCACGTGGGAGCCTCAGCAATCTGCTGCCTCCTGCTTTCGAAGACAGTGGTAGAAAGGGTCTGGGGCAAAGCACATGGG - UNI2

2760 - ATCCAGATGCCCTCAGTGCTATGTGCCCACCTGTTTGGCAGCTCGGACTGCCCAGTTCTCAGTGGCT - UNI22760 - GGCGCTGTGTAT

CGAGTGTGTGCAGGAACTGCCACCTTCCACCTGCTGCAGGCTGTGCTGCTAGTTCGCCTCCACTCCCCCACCAACCCTCGGGCACAGCTGCATAACAG C

TTCTGGAGCCTCAAGCTGTTGTTCCTGTTAGGTCTCTGTGTCGTTGCCTTCTGCATCCCTGATGAGGATCTCTTCCCAG CCTGGCATTATATTGGCATC

TGTGGAGGCTTCACATTCATCCTATTACAGCTGGTGCTTATCACAGCCTTTGCCCAGTCCTGGAACAAGAATTG GCAGACTGGTGCAGCTCAAGACTGT

AGCTGGCTCCTAGGTGTGTCACTGGCCACACTAGGGTTCTACAGCATGGCGGGTGTGGGAGCTGTGTTGCTGTTCCACCAGTACACACACCCTGACGGTT

GCCTGCTCAACAAGATGTTACTCAGTCTGCACCTTTGCTTCTGTGGCCTCCTGTCTCTCCTCTCCATCGCACCTTGCATCCGCCGCA AGCAACCAAACT

CTGGCCTCCTACAAGCCTCTATCATCAGCTGCTATATCATGTATCTGACCTTCTCTGCACTGTCCAGCCGTCCCCCAGAGACAA TAACCTTTCAAGGAC

AGAATCACACCTTGTGTCTGCCTGGCCGGAATAAAATGGAACCACAAATACCGGATACCTCAGTAGCAGTGTTTAGTGCTGGCATCATGTATGCTTGTGT

GCTCTTTGCTTG CAACGAGGCTTCCTACCTGGCCGAGTTATTTGGACCCTTGTGGATTATCAAGGTTTACAAGTATGAGTTCCAG - UNI6492 - A

AGCCCTCAGTCTGTTTCTGCTGCCCCCAAACAGTGGAGCCAGAGGATG - UNI6492 - GGCAAAGGAGCAGGGCCAGGTCAGCTGACCAAGAGACCC

CTCCAGCTGCTCAGGTGCAGAGCCAGCATCTTTCCTACAGCTACTCTGGCTTCCACTTCGCCTTCTTCCTTGCTTCACTCTATGTCATGGTTACCCTTAC

CAACTGGTTCAG CTATGAGGAAGCAGAACTGGAGAAGACCTTCACTAAGGGTAGCTGGGCTACCTTCTGGGTTAAAGTTGCCTCATGCTGGGCCTGTGT

CCTCCTCTATCTGGGGCTGCTCCTGGCACCACTGCTGGCTCCCCACTCAGAATCACCACCACCCTAGTATATTCAGGCAACACTGCCATGGCATCAGTAC

TGCCACATAAAAACTGGCTCTTGATCTGTAGTAACAAACTGGGAGACAGACCCTTTAGATTATGCTCTTAATCTTAGCTCCAGGAACACCCAGCTGAACT

CAATACCTCAAGGACAAATGAGCAGTTATCGGTGCATAGGCTCAGTAAGTATCTAAATTTGAAGAAGCAGACAAACTCACTAGTTCATTAAAGCTCAAGA

GTCTAACTCCCAGGAAGTAAACCCAGGAGCCTTACCTGATCCTAGCAGTGTGGCACAAGACCCTTTCTGGTTCCAGGGCTGGAGATAAGGTCAGGGAAAG

ACCTACAGAGATTGAAGATTTGGGTCTGCTCTTAGCAATCAAAAGGAAATGAGTAGCTCAGCCCTAAGCAGTGGTGGAAGAAGCCCAGACCACAGAACAA

ACCAGGGCAGGGGAAGAAGGGAGCAGAGGCTACCATAGGTTTTAATCCTGGTCTTGAGGTCAAAGGAAATGGAAGACAAAAACCACCTTCATTCCATGAG

GATTGACAGAACAGAAGAGAATGTGAGCATCCAGAGTGGCTGACCACCAGAAGTTGGTGAGCAGCAGGATTTTTTTTTTTGGCCAACTTTCAAGCAAACA

AAGAATGAAGAGACATAAATTTGGGTCTTAGATCCTTCCCTCTTATGACCCTCAATACCATCCTGGGGATGGTGTCCAAGGTCGGTGTGGGGGATAAAAA

TCACAGAAAAGAAGTCTCTATAGTTCTTAGAGGACTCCTCTGCCATATAACTGGAGTGCTTTTCCGGTTGCAATAGTTAAAATAAAGGCTTCTTCTGTGA

TGTTTTCC
Translation
 MG - UNI22760 - GSRCPQCYVPTCLAARTAQFSVA - UNI22760 - GAVYRVCAGTATFHLLQAVLLVRLHSPTNPRAQLHNS SFWSLKLL

FLLGLCVVAFCIPDEDLFPA AWHYIGICGGFTFILLQLVLITAFAQSWNKNW WQTGAAQDCSWLLGVSLATLGFYSMAGVGAVLLFHQYTHPDGCLLN

KMLLSLHLCFCGLLSLLSIAPCIRRK KQPNSGLLQASIISCYIMYLTFSALSSRPPETI ITFQGQNHTLCLPGRNKMEPQIPDTSVAVFSAGIMYACV

LFAC CNEASYLAELFGPLWIIKVYKYEFQ - UNI6492 - KPSVCFCCPQTVEPEDG - UNI6492 - GQRSRARSADQETPPAAQVQSQHLSYS

YSGFHFAFFLASLYVMVTLTNWFS SYEEAELEKTFTKGSWATFWVKVASCWACVLLYLGLLLAPLLAPHSESPPP

For any suggestions or comments, please send an email to unitrap@crg.es