Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000046139 (Patl1)
Chromosomal location
Chr 19: 11986948 - 12019456 (+)
Description
protein associated with topoisomerase II homolog 1 (yeast) Gene [Source:MGI Symbol;Acc:MGI:2147679]
RefSeq_dna
NM_172635 
RefSeq_peptide
NP_766223.1 
UniGene
Mm.42711 Mm.470206 
MGI
MGI:2147679 
Uniprot/SWISSPROT
Q3TC46 
Human Ortholog
ENSG00000166889 (PATL1)
Omim not available
UniTrap UNI24267
Vector Insertion
Chr 19: 11987068 - 11988837
Public Clones not available
Private Clones OST226272 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4995
Vector Insertion
Chr 19: 11988950 - 11994667
Public Clones YTC391 (baygenomics) YTC088 (baygenomics) YTC390 (baygenomics) YHB333 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27631
Vector Insertion
Chr 19: 11999717 - 12004364
Public Clones not available
Private Clones OST54955 (lexicon)
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32142
Vector Insertion
Chr 19: 12011870 - 12014173
Public Clones IST11910F3 (tigm) IST12150G3 (tigm) IST12525A6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000061618
Sequence
CGAGCCGGTGGGAGACCCGCGCGCGCGGAGCAGCCCGGGGAGTCGGCGCTTCTTTTCCCTCCCTCCCCCCACTCCCCTCCCCGCTCCCTTCCCCCCTCCC

CAAGAATGTTCCGCTACGAG - UNI24267 - TCTTTGGAGGATTGTCCTCTAGATGAAGATGAAGATGCATTTCAAGGCCTGGGAGAAGAAGATGAA

GAAATTGATCAATTTAATGATGATACCTTTGGGTCAGGTGCAGTTG - UNI4995 - ATGATGATTGGCAGGAAGCACATGAGCGCCTGGCTGAGTTG

GAAGAGAAGCTACCTGTGGCAGCTGATGAACAAACAGGCAATGGAGAGAGAGATGAGATGGATTTGTTGGGTGACCATGAGGAGAATCTAGCAGAAAGGC

TCAGTAAGATGGTGATTGAAAATGAGCTAGAAGATCCAGCTATCATGAGGGCAGTACAGACCAGGCCAGTTTTACAA CCTCAACCAGGAAGTCTGAATT

CCAGCATCTGGGATGGATCTGAAGTTCTGAGGCGAATCCGTGGACCACTACTTGCTCAG GAAATGCCTACAGTGTCTGTATTAGAGTATGCCTTGCCTC

AGAGGCCCCTGCAGGGCCCAGAAGATGATCGGGACCTTTCTGAGCGAGCTTTACCAAGGCGGTCAACATCACCTATCATTGGAAGTCCTCCTGTTAGAGC

CGTTCCTATAGGCACCCCACCTAAGCAGATGGCTGTTCCCAGCTTCAACCAACAG ATCCTGTGTCCGAAGCCTGTTCATGTTCGGCCCCCAATGCCGCC

ACGCTATCCTGCTCCCTATGGCGAGAGGATATCTCCAAACCAGCTCTGCAGTGTCCCG AACTCCTCCCTCCTGGGCCACCCTTTTCCTCCTAATGTTCC

TCCTGTACTTAGTCCCCTGCAGAGAGCACAGCTTCTTGGGGGAGCACAG CTACAGCCTGGACGAATGTCTCCCAGCCAGTTTGCACGGGTCCCTGGGTT

TGTTGGTAGCCCACTGGCTGCCATGAATCCTAAGTTGCTACAAGGGCGCGTTGGGCAGATGCTTCCCCCAGCACCAAGCTTCCGTGCCTTCTTTAGTGCT

CCACCCCCCGCTACGCCACCTCCACAGCAGCATCCCCCTGGCCCAGGACCTCACCTACAAAACCTCAG ACCTCAGGCCCCAATGTTTAGAGCAGACACA

ACTCACCTTCATCCACAGCACCGGCGCCTGTTGCATCAGAGGCAGCTGCAGAGCAGAAA - UNI27631 - TCAGCATCGGAATCTCAATGGTACTGG

AGATAGAGGAGGGCACCAGTCCAGTCATCAAGATCATCTCCGGAAGGATCCATATGCTAATCTAATGTTGCAGCGGGAGAAGGATTGGGTCTCTAAAATA

CAGATGATGCAGCTGCAGAGCACTGATCCCTACCTGGATGATTTCTATTACCAG AATTACTTTGAAAAACTGGAGAAATTGTCAGCTGCTGAGGAAATA

CAAGGTGATGGCCCTAAGAAGGAGCGTACCAAGCTCATCACCCCTCAGGTGGCCAAACTGGAGCATGCTTATCAGCCTG TGCAGTTTGAGGGCTCGTTG

GGGAAGCTTACTGTCTCTAGTGTGAATAATCCTCGGAAGATGATAGATGCTGTTGTGACATCTCGAAGTGAGGATGAT GAAACAAAAGAAAAACAAGTT

CGGGATAAGAGAAGAAAAACCCTTGTTATAATTGAGAAA ACCTATAGTTTACTCCTTGATGTGGAGGATTATGAAAGGCGCTATCTCCTAAGTCTAGAA

GAAGAGCGGCCTGCCCTGATGGATGAAAGAAAGCACAAAATATGTAGCATGTATGACAACCTGAGGGGCAAATTGCCTGGACAAGAGAG GCCAAGTGAT

GACCACTTTGTACAGATCATGTGTATCCGAAAAGGGAAGAGAATGGTTGCCCGCATTCTCCCTTTCCTCTCCACAGAGCAAGCAGCTGACATTCTCATGG

CAACTGCCAGGAACCTCCCTTTCCTTATCAAGAAGGATGCCCAAGATGAG - UNI32142 - GTGCTGCCATGCTTACTGAGTCCCTTCTCTCTCCTC

CTCTATCATCTTCCTTCAGTGACTGTCACCAGCCTTCTGCAACAGCTAATGAACCTACCTCAGAGTGCAAGTGCACCAGCGCCCTCCAACTCTCACCTCA

CTGCTGTGCTCCAGAACAAG TTTGGCTTGTCACTGCTCCTAATCCTACTAAGCCGTGGAGAAGACCTACAGAGTTCAGATCCTGCTATAGAATCAACGC

AAAATAACCAGTG GACAGAGGTGATGTTCATGGCAACCCGAGAACTTCTACGGATCCCCCAAGCTGCCCTGGCCAAACCAATCTCTATCCCTACAAATC

TAGTGTCCCTTTTTTCTCGCTATGTTGACCGGCAGAAACTGAACTTGCTGGAAACAAAACTGCA GCTGGTTCAGGGGATACGGTAAAAGATCTCCAGAG

TATCCTGTACCTCCTGTTGGCTGCCACCTGCACTGCTGCCATCACCAATGGAGTGTTTTTAATGAGGGAGGGGAGGTAGCTTATGACCCAAAGCAAAGTC

TTGTGGGATCCATTCCTGTTTTCAGAAGTTAGCTCTGAATGCCAGGTATTCCCGCTGCTCTGATACTTCTGCTGGGTGGTACTTCTGCTGGTTTCTTTTA

CCTTCTGCGTTACACTTTTGCATGTCCTACTTTTACTCAATTCTTCTCAATTTTGCATTTTCTTTGCCCTAGAGACACAACAAACGTCCCTTTATCCCAT

CACCACTATTACAATTCAAAGTAGGTTGTAGTATACCAAAGGACTCCTTCCCGCTTTGAAGTCTTTTTTTCATCTCCCCTTATTAATATGATTATAGGAG

AGTCAAAATTAAGTAGAAGTCAAGATATAGGTAAATATATAAACACCCTACACAAACATTCGTATGATCTCCAGAGGGTCCTTAAAGAATAAGTTTGTTT

GAAAAATATTTAGTTAACATATACCTCTAAAAATAAACCAGCCGATATATTTTTAATCTGTTTCTGTTCCATCTTGTCATTTGGTGGATTCTACTTTTTT

AATATATAAATACAGGGTATACAGCATATTACATTAAATCAAACTTGTTAGTTGGCTGATGCCCAGTTCTAGGCTGAGAGGACTTTTCTTTCTCCTAACC

TGTATTTCCTTTGTTTCTGACAACCATAATAGAAACAGCACACACACGGTTAAGCCTTTTCCTGTGATGACTACAGCGTGCTTGAGAGTCTGTCCCTCAA

GTGCATTCAAGAGTACCCAAGATGAGCCTCACGTAGAGCCTGCTTCTGCAGTGTAGCTTTTGTGCGCCTGCACTGTCTTCCTGACGTGACTTCTGTAAGC

CATGCTTCTGCTCCTCTTCCCCATTTTCATTTAGTGTCTTGGGTAGAAACCTCCAAATGTAGCCGTGGCTGCTCAGCTTGGGCTCTGCTCTTCAGTGTCC

TCTACCCTGCAGCAGAACTGCTGTCCTGGCTGCTGAGTCTCACCTGAGCCCCATCCACTGCAGCCAGCAGGGCCTGGGTGTGAATCTTAGGGACACTTCC

CTTCCACTCACTTTTCTTCCCTTCAGCAGTCAGCCAGGATAAGGGACTCGGCTCCCTAGTGGTTACAGTTCTGAAAAAAATAAATTGAATTTATTTTATA

TTCCCTTCCTGATCCTACTTTCTGCTGTTCTCACCTTTTTGAATGTAGTCGGGGGACAGGCTATGATATTTAAAGAGAATAAACGTTTTGCACATACATG

TATTGTATAACAGTAAAGCCCTCCGTTACAACCAGCTGTCTTTGTACTCATCTCCATTTCTTCTCATTTTGTGGCCTCGGGCTCCACCAGCTGCTCCCCA

GTGACAGTCCCTAGCTTCCTTCTACCATCTACTGACTGTCTCCACTGAGCCTTTCCTACCTTCCCTTCACACCCGATCAAGTAAACACTTGATTATTTTT

TTCTTCCTTATTGTGCTTTTTGTTCAGTTCTAATTAATAAAATAAAATTTCTAAATTTACATTTTTATAGGGTATTGTAAATAAAACAAATTGTATACTT

G
Translation
MFRYE - UNI24267 - SLEDCPLDEDEDAFQGLGEEDEEIDQFNDDTFGSGAVD - UNI4995 - DDDWQEAHERLAELEEKLPVAADEQTGNGE

RDEMDLLGDHEENLAERLSKMVIENELEDPAIMRAVQTRPVLQ PQPGSLNSSIWDGSEVLRRIRGPLLAQ EMPTVSVLEYALPQRPLQGPEDDRDLSE

RALPRRSTSPIIGSPPVRAVPIGTPPKQMAVPSFNQQ ILCPKPVHVRPPMPPRYPAPYGERISPNQLCSVP NSSLLGHPFPPNVPPVLSPLQRAQLLG

GAQ LQPGRMSPSQFARVPGFVGSPLAAMNPKLLQGRVGQMLPPAPSFRAFFSAPPPATPPPQQHPPGPGPHLQNLR RPQAPMFRADTTHLHPQHRRLL

HQRQLQSRN - UNI27631 - NQHRNLNGTGDRGGHQSSHQDHLRKDPYANLMLQREKDWVSKIQMMQLQSTDPYLDDFYYQ NYFEKLEKLSAAEEI

QGDGPKKERTKLITPQVAKLEHAYQPV VQFEGSLGKLTVSSVNNPRKMIDAVVTSRSEDD ETKEKQVRDKRRKTLVIIEK TYSLLLDVEDYERRYLL

SLEEERPALMDERKHKICSMYDNLRGKLPGQER RPSDDHFVQIMCIRKGKRMVARILPFLSTEQAADILMATARNLPFLIKKDAQDE - UNI32142 

- VLPCLLSPFSLLLYHLPSVTVTSLLQQLMNLPQSASAPAPSNSHLTAVLQNK FGLSLLLILLSRGEDLQSSDPAIESTQNNQW WTEVMFMATRELL

RIPQAALAKPISIPTNLVSLFSRYVDRQKLNLLETKLQ QLVQGIR

For any suggestions or comments, please send an email to unitrap@crg.es