Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000046186 (Cd109)
Chromosomal location
Chr 9: 78463584 - 78564058 (+)
Description
CD109 antigen Gene [Source:MGI Symbol;Acc:MGI:2445221]
RefSeq_dna
NM_153098 
RefSeq_peptide
NP_694738.1 
UniGene
Mm.32955 
MGI
MGI:2445221 
Uniprot/SWISSPROT
Q8R422 
Uniprot/SPTREMBL
A6MDD3 
Human Ortholog
ENSG00000156535 (CD109)
Omim not available
UniTrap UNI28242
Vector Insertion
Chr 9: 78463760 - 78464683
Public Clones not available
Private Clones OST36177 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31957
Vector Insertion
Chr 9: 78464857 - 78482453
Public Clones IST12672D8 (tigm) IST14440H3 (tigm) IST14899C6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093812
Sequence
GCTAAACCCTGGTGTGAAGCGGGACAGGCCAGGGCAGGAGGTGGCCAACCACACCCCGCAGGGCGCGCACTTGGCGGGCTGCAGACCCCACGGGCAGACG

CCGAGATGCGCAGTCGGAGGCTCCTGAGCGCGGCCCACCTTCTCTGCTTGTGCGCGGTCGCGCTGGCCGCCCCAGG - UNI28242 - GTCCCGCTTT

CTGGTGACAGCCCCAGGGATCATCAGACCCGGAGCAAATGTGACTATTGGGGTGGATCTCCTGGAAAATAGCCCCCCACAGGTCCTTGTAAAGGCTCAGG

TGTTCAAGATAGCTTCCAACAAATCGAGATCCATCCTGGAAGCAGAAGGAGTCTTTCACAGAG - UNI31956 - GCCATTTCAAGACTCTCGTTCTT

CCGGCA CTACCTCTGAGCAGTGCAGATAAGATTTATGAGCTACACATAAACGGACAATCAGAGAATGAGATCGTATTCTCCAACAGGACACGTTTAACA

TTTGAGAGCAAGAGTATATCTGTCCTCATTCAGACAGACAAGGCATTCTACAAGCCGAAGCAGGAAGTGAAGTTTCGGGTGCTCACACTCTGCTCAGATC

TCAAGCCTTATAGGACATCCGTGGACATTTTCATTAAG GATCCGAAGTCTAATGTGATCCAACAGTGGTTTTCTCAGAAAGGTGATCTTGGAGTCGTTT

CCAAAACTTTTCAACTATCCTCTAATCCAATATTTGGTGACTGGTCCATTCAGGTTCAAGTGAAT GATCAGCAATATTACCAGTCATTTCAGGTCCTAG

AATATG TGTTACCAAAGTTCGAAGTCACCGTGCAGACCCCGCTGTATTGTTCCTTGAAGTCTAAACAGTTAAATGGCTCCGTCATAGCAAA GTATACA

TACGGGAAGCCAGTGAAGGGAAGTCTGTCACTTACATTTTTACCTTTGTCTTTTTGGGGAAAGAAGAAGAATATCACAAAAAGTTTTGAG ATAAATGGA

TTTGCAAACTTCTCTTTTGATAATTATGAGATGAAAAAGGTAATGAATTTGAAACCGCTAACGGATGTCTCGGAAGGGAGTTATGAGAATGTGGACCCGT

CCTTTCCTGGGCCGGCAGAGATTATAGCTACTGTGACGGAATCACTCACAG GTATCTCAAGAATGGCAAGCACCAATGTGTTTTTCAAGCAACATGATT

ACATCATTGAGATTTTTGATTATACGACTGTCTTGAAACCATCTCTCAACTTCACAGCCACT GTGAAGGTCAGCCGCTCTGATGGCAATCAACTAACTC

CTGAAGAAATAGAAAATGATTTGGTCACAGTAGTGACCCAGCGGAAAAATAACCACCCTGAGAGTCAGAGAGATCAGGAAATGGATTATATCCAGACCGT

AAATTATACTATCCCCCAAAATGGAATCATTAAGATTGAATTCCCAGTCATGTCCATTTCCGGCGAGCTACAACTGAAG GCTTATTTTCTTGATGGTAC

AAGTTCTGTGACAGTCCACAGTATGTTCACCTCTCCTAGTAAGACGTACATCCAGCTTAAAACCAGAGATGAATATATAAAG GTGGGGTCACCTTTTGA

TTTGATGGTTAGTGGCAACAGACAATTCAAGGACTTAAGCTATATG GTAATATCAAAGGGACAGTTGGTGGCTGCAGGCAAACAAAGTTCAAGAACTTT

CTCTTTAACACCAGAGGCTTCCTGGGCTCCAAAGGCCTGTATAATCGCATATTATATTGCAGAGGATGGGGAAATTATAAATGATATTCTAAAAATCCCC

GTTCAGCTTGTTTTTGAAAATAAG GTAAAGCTGTTTTGGAGTAAACCTACAGTCAAGCCATCTGATAAGGTCTCTCTCAGGATCTCTGCGACACAGTCT

GACTCCCTGGTGGGGATTGTAGCTGTTGACAAAAGTGTAACATTGATGGAAAACTCCAACAGTATTACAATGGAAACC ATGGTCCATGAACTGGAACTT

TATAACACAGAATATTATCTAGGCATGTTCATGAACTCCTTCGCTGTATTTCAG GAATGTGGTCTCTGGGTGTTGACAGATGCAACCCTTATAAGAGAT

AGCATTGATGAAGTCT ACGATACTGAAGAGTATTCTGAACGCTTTGCAGAGGAAAATGAGGCAAACCTGGTTGATTTTGAAGATGCTTCTTCAGTTAAC

AATGTACATGTCAGGAAGAATTTTCCAGAAACATGGATTTGGCTAGACGCCTACATGGG ATCTAAGATTTATGAAGAATTTGAAGTTACTGTACCTGAC

TCCATCACTTCTTGGGTGGCTTCGGCTTTTGTCATCTCAGAAGACCTGGGTTTTGGGTTAACAACCGTTCCAGCAGAG CTGCAAGCCTTCCAACCGTTT

TTCCTTTTCCTGAATCTTCCGTACTCTGTTATCAGAGGTGAAGAGTTTGCTTTGGAAGTATCCATCGTCAATTATTTGAAAGATACAATTAAG GTTGTG

ATACTCATTGAGGAAAGTGACAGCTTTGATATTTTAATGACTTCAAATGACACCAATGGCACCATATACCGGAAGACTGTTCAAGTTCCCAGGGATAATG

GGGTCACTCTTGTTTTTCCCATCAAGCCCACGCACTTGGGAGAGATTCCCATCACAGTGACGGCTGCCTCACCCACTGCCTCTGATGCTGTCACCCAGAC

AATTGTAGTAAAG CCTGAAGGGATAGAAAAGTCGTATTCGAAATCTGTCTTATTGGATCTGACAGATAGCAACGTAGAAAGTAAGCAGCAATCTATGAG

ATTCTCCTTTCCTCCTGATACGGTCATTGGCAGTGAAAGAGTTCAGATCACAGCAATTG GAGATATCCTTGGTTCCTCCATCAATGGCTTATCTTCACT

GATCCGGATGCCTTATGGATGTGGTGAACAGAACATGATATATTTTGCTCCAAATATTTACATTTTGGATTATCTGACTAAACAGAAACAGCTGACAGTT

AATTTAAAAGAAAAGGCCCTTTCATATATGAGGCAAG GTTACCAAAGGGAGCTTCTCTATCAGAGGGAAGATGGCTCCTTCAGTGCTTTTGGGGACATT

GACTCTTCTGGGAGCACTTG GCTGTCAGCATTTGTTTTAAGATGCTTTCTGGAAGCTGATTACTATATAGATATTGATCAGGATGTGTTACACAGAACA

TATACTTGGCTTAATGCACATAAGAAATTCAATGGTGAATTTTGGGAGCCAGGAAGAGTGATTCACAGTGAACTTCAAGGTGGCACCAAAAGCCCAGTAA

CACTTACGGCCTATATTGTGACTTCTGTCCTGGGATACAAAAAGTATCAG CCTAATATCGATGTACAAGACTCAATCAAGTTTTTGGAATTTGAATTCA

GCAGAGGAATTTCGGACAATTATACCTTAGCAATTATATCCTATGCCCTGTCCACAGTCGGGAGCCCTAAAGCAGAGGAGGCTTTGAACTTGCTGATGCA

GCGATCAGAAAAGGAAG GAGACACACAGTTCTGGTTGTCATCAGGACCTGCGCTCTCTGGGTCCTGGCAGCCGCGCTCCGTGGACATCGAAATCGCTGC

TTATGCACTGCTGGCGCACACTCTGCACCATGTGTCTGAGGGAATCCCGGTTATGAGGTGGCTCATCCAGCAAAGAAACAGCCTGGGAGGTTTTGTATCC

ACTCAG GATACTGTTGTGGCCCTGAAGGCATTATCTGAATTTTCAGCCCTTGTGCACAAGGAAAATACAGATATCCAACTGACCGTCACAGGGCCCGGC

ATCCCCAGATCCATACACTTCCGAATTGACTCCCAGAACCTCTTTCTCCTTCACCAGGAAGAG CTTCATGCGCTAGATCCCATCACCGTTAATGTTTCT

GCGCATGGCTCGGGATTTGCTATTTGCCAG CTTAATGTTGACTATAACGTGAAAGGTTCAGGTTCTTCTAAAAGACGGAGATCTACCGAAAATCAAGAA

GTTTTTGATTTAGACGTCATTGTGAATAATGAGGACGACATTAGTCACCTGAATCTGAATGTGTGCACAAG TCACTTGGGTTCAGAGAGGACAGGCATG

GTCCTTATGGAAGTGAACCTTCTCAGTGGCTTTAGTGCATCTTCAGATTCAATTCCTCTGAGTGAGACCCTGAAGAAAGTGGAATATGATAACGGGAAAC

TCAACCTTTATTTAGATTCT GTAAATGAATCCCAGTTTTGTGTTAATATTCCCACTGTGAGAGACTACAAAGTTTCAAATATTCGAGATGGTTCAGTAT

CTGTAATGGACTACTATGAACCAA GGAGACAGGCAGTGCGAAGCTACAACACCCAGGTGAAGCTGTCCTCATGTTACCTCAGTCCAGACACCAACTGCA

AGTCACACACGGACGGAGCCACGGACTCCCTTCGACGTTCTTCGAGCCTTCTCGTCTTTTGCTCCGTCCTTCTGTACTTTGTGCAACATTGATTATGATT

TATTTTTCAAGGACTCCGTCTAAAACTAGCATTTCCAGAAAGTCAAGTGTGATTGTTTTCTTTCTACACCTGATGATTGCCTCTGACGGTTCTGAAAATC

AATTGTTTCCCTTTCCTGGGGGGGCCTGGGGAGTGTAACAGGCCAGAGCTTGTGTAAGCACGTAAAACAATTCACCCAATCTTTGTGTGGAAGATGACCA

GGATGACGACGCCATGTCTCTATATCTCCTTCTCTAGGAAAGTTTATTAGATGCATTTGTTTTTGCTAGAATAAAAATGTTATTTTCCATTATTCCTGTT

TTGTAAAAGATGTGAGGGGTGGGGGTTCTCCTGTATCCAGTCCTTCAGCATCTGCCCTGGTGTTATCATCGCAGCAACAGGAGGTACTTTGCTCTCTGTT

CCTTCCCACATCTGGCCTGACTCTGCTGTAGGCCCATCCCACTGTCTCAGTGAGACTCTCTGATCAGCACGCTGACTCTTTCTTAGAATGTAGGTAGTAA

GTTTTTAAAAGTAAAATGGTCTTTTTCTGCTGCAGCTCTGATGACCTGCCCCAGACTTGACTCTCCCCAATTTCTTTATAGAGAAATTTTCCTGTCTTAA

ACATTTCCTGTATCATGCTGCTGTATTACACTGAAAGTTGCCTTCAAGGGTTGCTGGGGTGTTCTCTTCTGTCATGGCGACAGTCTCACTCTGACCCTGC

TTCAGGAGTGCAAGCTGGAGAGCCCTCTGACATATGCCCACGTGACTTGGCCTAGAAGAGCTCATTCCAGGAGACACTCTGAACTGAGAGTATGAGGAAT

ATTGCTCTGTGTCACAGCCTACCCATCCCCCCGGGAAACAAGCTGAGCTTGAAGACCTCAGAGAGTCAGGACACAATTCTGCCCGAAGTTCTATAGTGCT

GGTCCTGGCTGCTGTTCAGTCTCTTCCAGCCACAGGGTCTGGGTATTGGGCTGTATGGCGCCCAGTGATGCTGTAAGTCATTAAGAAGATTCTTGTGTTC

TCAGTCAAATTTATTCTGGAGTATGGGATTTATTGGTTTTTCTTTTTTGTAAGCACTTAAAGAAATATTCTTTCCTCATCTCTTCATTCCTTTTCTCCCC

TCTTCTCTCCCTTTCAGTGTTCCCTGTTGAGTACTCTGAAATAGGTTACATATGTAAAAATTCAAAGATTAAAACAAATCAATCT
Translation
MRSRRLLSAAHLLCLCAVALAAPG - UNI28242 - GSRFLVTAPGIIRPGANVTIGVDLLENSPPQVLVKAQVFKIASNKSRSILEAEGVFHRG - 

UNI31956 - GHFKTLVLPA LPLSSADKIYELHINGQSENEIVFSNRTRLTFESKSISVLIQTDKAFYKPKQEVKFRVLTLCSDLKPYRTSVDIFIK 

DPKSNVIQQWFSQKGDLGVVSKTFQLSSNPIFGDWSIQVQVN DQQYYQSFQVLEYV VLPKFEVTVQTPLYCSLKSKQLNGSVIAK KYTYGKPVKGSL

SLTFLPLSFWGKKKNITKSFE INGFANFSFDNYEMKKVMNLKPLTDVSEGSYENVDPSFPGPAEIIATVTESLTG GISRMASTNVFFKQHDYIIEIFD

YTTVLKPSLNFTAT VKVSRSDGNQLTPEEIENDLVTVVTQRKNNHPESQRDQEMDYIQTVNYTIPQNGIIKIEFPVMSISGELQLK AYFLDGTSSVTV

HSMFTSPSKTYIQLKTRDEYIK VGSPFDLMVSGNRQFKDLSYM VISKGQLVAAGKQSSRTFSLTPEASWAPKACIIAYYIAEDGEIINDILKIPVQLV

FENK VKLFWSKPTVKPSDKVSLRISATQSDSLVGIVAVDKSVTLMENSNSITMET MVHELELYNTEYYLGMFMNSFAVFQ ECGLWVLTDATLIRDSI

DEVY YDTEEYSERFAEENEANLVDFEDASSVNNVHVRKNFPETWIWLDAYMG GSKIYEEFEVTVPDSITSWVASAFVISEDLGFGLTTVPAE LQAFQ

PFFLFLNLPYSVIRGEEFALEVSIVNYLKDTIK VVILIEESDSFDILMTSNDTNGTIYRKTVQVPRDNGVTLVFPIKPTHLGEIPITVTAASPTASDAV

TQTIVVK PEGIEKSYSKSVLLDLTDSNVESKQQSMRFSFPPDTVIGSERVQITAIG GDILGSSINGLSSLIRMPYGCGEQNMIYFAPNIYILDYLTKQ

KQLTVNLKEKALSYMRQG GYQRELLYQREDGSFSAFGDIDSSGSTW WLSAFVLRCFLEADYYIDIDQDVLHRTYTWLNAHKKFNGEFWEPGRVIHSEL

QGGTKSPVTLTAYIVTSVLGYKKYQ PNIDVQDSIKFLEFEFSRGISDNYTLAIISYALSTVGSPKAEEALNLLMQRSEKEG GDTQFWLSSGPALSGSW

QPRSVDIEIAAYALLAHTLHHVSEGIPVMRWLIQQRNSLGGFVSTQ DTVVALKALSEFSALVHKENTDIQLTVTGPGIPRSIHFRIDSQNLFLLHQEE 

LHALDPITVNVSAHGSGFAICQ LNVDYNVKGSGSSKRRRSTENQEVFDLDVIVNNEDDISHLNLNVCTS SHLGSERTGMVLMEVNLLSGFSASSDSIP

LSETLKKVEYDNGKLNLYLDS VNESQFCVNIPTVRDYKVSNIRDGSVSVMDYYEPR RRQAVRSYNTQVKLSSCYLSPDTNCKSHTDGATDSLRRSSSL

LVFCSVLLYFVQH

For any suggestions or comments, please send an email to unitrap@crg.es