Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000046201 (Rbm16)
Chromosomal location
Chr 17: 3114967 - 3198855 (+)
Description
RNA binding motif protein 16 Gene [Source:MGI Symbol;Acc:MGI:1925212]
UniGene
Mm.124373 
MGI
MGI:1925212 
Uniprot/SPTREMBL
Q8C9D3 Q3TTX6 Q3TZC7 Q5U5V8 Q6DID3 Q80TJ3 Q8C037 Q99LN2 
Human Ortholog
ENSG00000213079 (RBM16)
Omim not available
UniTrap UNI1267
Vector Insertion
Chr 17: 3115419 - 3145074
Public Clones (sanger) DD0553 (sanger) DD0552 (sanger) XB591 (baygenomics) XA153 (baygenomics)
D070G02 (ggtc) PST20604-NR (escells) IST11978G10 (tigm) IST14001F11 (tigm)
IST14971H10 (tigm) IST14430G2 (tigm)
Private Clones OST310224 (lexicon) OST297623 (lexicon) OST139040 (lexicon) OST36951 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36152
Vector Insertion
Chr 17: 3145159 - 3148535
Public Clones IST14780C6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14525
Vector Insertion
Chr 17: 3150944 - 3159162
Public Clones (sanger) D153F04 (ggtc) D076H09 (ggtc) E076D06 (ggtc) D076G09 (ggtc)
D077H08 (ggtc) D077E07 (ggtc) CMHD-GT_536C4-5S (cmhd) FHCRC-GT-S7-6E1 (fhcrc)
IST14879E5 (tigm) IST14849D3 (tigm) IST14794D2 (tigm)
Private Clones OST30163 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28324
Vector Insertion
Chr 17: 3159325 - 3162958
Public Clones (ggtc)
Private Clones OST33863 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32063
Vector Insertion
Chr 17: 3169407 - 3171102
Public Clones IST14823B2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI157
Vector Insertion
Chr 17: 3178349 - 3185063
Public Clones GC0144 (tigem) XC201 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36623
Vector Insertion
Chr 17: 3185875 - 3187588
Public Clones IST14585A6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31029
Vector Insertion
Chr 17: 3191962 - 3193013
Public Clones IST10299B4 (tigm) IST10702G11 (tigm) IST13920F4 (tigm) IST14118C8 (tigm)
IST14255D5 (tigm) IST13796D8 (tigm) IST12809D1 (tigm) IST13377E12 (tigm)
IST11074G1 (tigm) IST13459H4 (tigm) IST13034C3 (tigm) IST13749A5 (tigm)
IST13034B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9293
Vector Insertion
Chr 17: 3193083 - 3195777
Public Clones XH057 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000082356
Sequence
ATATTGGATGCCGCAGCCGCCGCGGTCAGCGCTTCCTCCTGTGTCTTCGCTGCGCGCTGCAGGTTCCCGCGGCCTAGGCGGCAGGGAGGTGACACAGGAG

CCCGTGGGAGGAAGAGGAAGGAGGAGAAGGGGGTGGAGAGTGGAGGGGGCCGAAGCTTGAGTGTGGAGGCCGCTTCCGAGCGAGGCGGAGAAGCAGAGAA

GGCGCCGCGCCAGCCCCTCCCCCGCCGCCGACCCGCCCCGGCGGCCTCCGTCCTGCTCACTGCGCCCGCCCCGCGGCCATGCTGGGGCCTCGCCGGCGCT

GAGGAGCGTCGCCTGCTCGCAGTGCTCCGCGGCCTCCTGGGCCCGTCGCCCGCCTTTCCGCACGCATCGCACCCGGCCGCCGCCTCTTCCTCCGTCGGGC

CCCGGGCCTCTGCGCAGACAACATGGAGGCCGTGAAGACCTTCAACAGCGAG - UNI1267 - TTGTATTCACTGAATGACTATAAGCCACCCATTTC

TAAAGCAAAAATGACCCAAATTACAAAGGCAGCCATCAAAGCTATTAAG - UNI36152 - TTTTATAAACATGTGGTACAAAGTGTTGAGAAATTCA

TTCAGAAA ATTTATTTATTTATCATATGTAAGTACACTGTAGCTGTCTTCAGACACTCCAGAAGAGGACATCAGACTTCTGTTACAGATGGTTGTGATC

TACCCATGTGGTTGCTGGAATTTGAACTCTGGACCTTCAGAAGAGCAGTCAGTGCTCTTAACCGCTGA
Translation
MEAVKTFNSE - UNI1267 - LYSLNDYKPPISKAKMTQITKAAIKAIK - UNI36152 - FYKHVVQSVEKFIQK IYLFIICKYTVAVFRHSRR

GHQTSVTDGCDLPMWLLEFELWTFRRAVSALNR
Transcript ENSMUST00000076734
Sequence
GCAGCCGCCGCGGTCAGCGCTTCCTCCTGTGTCTTCGCTGCGCGCTGCAGGTTCCCGCGGCCTAGGCGGCAGGGAGGTGACACAGGAGCCCGTGGGAGGA

AGAGGAAGGAGGAGAAGGGGGTGGAGAGTGGAGGGGGCCGAAGCTTGAGTGTGGAGGCCGCTTCCGAGCGAGGCGGAGAAGCAGAGAAGGCGCCGCGCCA

GCCCCTCCCCCGCCGCCGACCCGCCCCGGCGGCCTCCGTCCTGCTCACTGCGCCCGCCCCGCGGCCATGCTGGGGCCTCGCCGGCGCTGAGGAGCGTCGC

CTGCTCGCAGTGCTCCGCGGCCTCCTGGGCCCGTCGCCCGCCTTTCCGCACGCATCGCACCCGGCCGCCGCCTCTTCCTCCGTCGGGCCCCGGGCCTCTG

CGCAGACAACATGGAGGCCGTGAAGACCTTCAACAGCGAG - UNI1267 - TTGTATTCACTGAATGACTATAAGCCACCCATTTCTAAAGCAAAAAT

GACCCAAATTACAAAGGCAGCCATCAAAGCTATTAAG - UNI36152 - TTTTATAAACATGTGGTACAAAGTGTTGAGAAATTCATTCAGAAA - U

NI14525 - TGTAAACCAGAATACAAGGTACCTGGACTATATGTTATTGACTCCATTGTGCGACAATCCCGGCATCAGTTTGGTCAAGAAAAGGATGTG

TTTGCACCCAGATTTAGTAATAACATCATTAGCACTTTTCAGAATTTATATCGTTGCCCTGGGGATGACAAG - UNI28324 - AGTAAAATAGTGAG

AGTATTAAACTTATGGCAGAAGAATAATGTTTTTAAGAGTGAGATTATCCAGCCTCTTCTGGATATGGCGGCAGGGATTCCTCCCCCAGTTGTCACGCCT

GTTTTGGCCAGCACCACTGCAGCTATGAGCAACACTCCAG GAACACCCGTGACACCTGTTACTCCAGCCAATGTGGTCCAAGGCTTACCTGATCCATGG

GTATCTCAGATAGCAAACACAGACACACTGGCAGCTGTTGCTCAGATCCTACAAAGTCCTCAAGGTCAACAG CTTCAGCAGCTAATACAAACCTTACAG

ATACAGCAGCAGAAGCCTCAGCCTTCTATCCTGCAGGCCTTGGATGCTGGTCTTGTGGTTCAGTTACAGGCACTCACTGCACAGCTCACAGCTGCAGCTG

CTGCAGCCAACACACTTACGCCCTTGGATCAGGGAGTCTCTTTCAACAAG AAGTTGATGGATAGATTTGATTTTGGGGAAGATTCTGAGCATAGTGAAG

AATCCAAAAAGGAAATGCCTACTCCTCAACT - UNI32063 - CTCTCACGTTTCAGAGTCTGTGAACAACTCCATCTTCCATCAGATAGCAGAACAG

CTGCAGCAGCAGAACTTGGAGCAGTTGCGACAGCAGCTCCTGGAGCAGCAGCAGCCTCAGAAG GTAACTCCTCAAGATAGCCAGGAGGGGACATTTGGG

TCTGAGCACTCAGCTTCTCCCTCACAAGGGAGTAGCCAACAGCATTTTCTGGAACCTGAAGCAAATTTAGATGATTCCATAGACATTCAGCAACAG GAT

ATGGATATTGATGAAGGGCAAGATGTTGTTGAAGAGGAGATCTTTGAACCAGAAGCTAAGAAAGTAGCTGTTCGCTCAAGATCAAGAACTCATTCACGAT

CTCGATCAAG GTCACCAAGAAAACGAAGGTCCAGGTCACGCTCTGGGTCCCGAAAGCGAAAGCACAGGAAGCGGTCTCGGTCCCACTCGAGAGAGAAAA

AGAGAAAAGCCTCACGCTCCTACTCCAGTGAGCGCAGAGCCAGGGAAAGGGAGAAAGAGCGCCAGAAAAAGGGCTTGCCTCCTGTCAGGTCAAAAACACT

AAGTG - UNI157 - TATGCAGCACTACTCTCTGGGTTGGCCAAGTGGACAAGAAGGCTACACAGCAAGATTTAACCAACCTTTTTGAGGAATTTGGA

CAAATTGAATCCATTAAT ATGATTCCACCCAGGGGCTGTGCATATGTCTGCATGGTTCATCGACAAGATTCATTTCGGGCTCTTCAGAAACTGAGTTCA

GGATCCTATAAAATTGGTTCCAAGGTCATTAAG - UNI36623 - ATTGCCTGGGCTTTGAACAAAGGTGTAAAGACAGAATACAAACAGTTCTGGGA

TGTGGATCTTGGCGTCACATATATACCCTGGGAAAAAGTGAAAGTAGATGACTTGGATGGCTTTGCAGAGGGCGGCATGATTGATCAGGAGACTGTAAAT

GCTG AATGGGAAACTGTGAAAGCCTCAGAACCTGTTAAAGAGCCAGTGCAGACTGCACAGAGTCCAGCTCCAGTTGAGAAGGAGTCAGTGGTCACCACA

CAGGCAGAGGTTTTCCCTCCTCCTGTCGCCATGCTGCAG ATTCCTGTAGCACCAGCTGTTCCTGCAGTTAGCTTAGTTCCTCCAGCGTTTCCTGTGTCG

ATGCCTGTCCCCCCTCCTGGATTCAACCCGATCCCTCCACCTCCTTTTCTACGAGCAAGTTTTAACCCTTCACAACCACCTCCTG - UNI31029 - G

TTTTATGCCACCTCCAGTTCCCCCACCTGTGGTACCTCCCCCTGCAATCCCACCGGTAGTACCAACAT - UNI9293 - CTTTAGTGCAACCACCATT

GTCCATGACCCCTGAAGCTGTGAAAGATGTTGGATTTGGCAGCCTGGTTTTACCAAGTGGTTCTGTTGCTGGCAGTCTTGCTCCTTCAACTCTACCAGCT

GGAAATGTTTTTAATCCTCCCAGTAAAGCAGAGCCTGAAGAAAAAGTACCTCACCTTATAGAGCACCAGATTCCTTCTGGTGAGAACACAAGACCAG TG

ATTCCAAGTGATATTCCAAGTAGTGCTGCAATGTTAGCACAGCCGCCTGGGGCCTCAAGCACCTCTGGGATCCTGTGCGTGCAGAGACCAAATGTATCAA

GTAATTCTGAAATTCTGGGGGTTCGTCCAGCTAATGTTTCCAACAGTGCTGCAATTATGGGAGCCCAGCCACCAAATATTCTAAATAACTCTGGAATTTT

GGCCATACAGCCACCAAATGTGTCCAGTGGCTCTGGACTTCTTGGGGTACTGCCTCCAAACTTGCCTAACAACTCTGGACTTGTAGGACTACAGCCACCA

AATGTTACAAGTCCTGCTGGACTTTTGGGAACACAGCCACCAATTGGACCTCAAAACTTACCACCTTTAGCCATCCCTGCTCAAAGGATGCCCGCGTTGC

CAATGTTAGACATTCGCCCAGGACTGATAGCACAGGCTCCCGGGCCACGATTCCCTTTACTACAGCCTGGAATTCCACCACAACGCGGTATCCCTCCCCC

ATCGGTACTTGATGCAGCTCTTCATCCTCCACCCCGCGGACCTTTTCCTCCAGGAGATCTTTTCAGTCAGCCAGAAAGACCTTTTCTGGCCCCTGGAAGA

CCAAGTATAGACAATGTTCCCAACCCAGATAAAAGAATACCACTTGGGAATGACAATATTCAGCAGGAAGGGGATAGAGATTACCGCTTTCCTCCTATAG

AAACCAGGGAGGGCATTACCAGACCTCCTCAGGTGGATGTTAGGGATGTGGTTGGGCGACGTCTAGATCCCAGAGAAGGCCCTGGAAGGCCTCCATTAGA

TGCTAGGGATCATTTTGGAAGACCTCCTGTGGACATGAGGGAGAATCTTGTGAGGCCAAGTCTAGACCACCTTGGTCGAAGAGACCACTTTGGCTTTCCC

CCAGAGAAGCCTTGGGGGCCTAGAGATTTTGATGAGAGAGAGCATCGAGTTCTGCCTGTCTTTGGTGGTCCAAAAGGCTTACATGAAGAAAGAGGTAGAT

TTCGGGCTGGAAATTACCGATTTGATCCTAGAAGTGGTCCTTGGAACAGAGGATTTGGTCAAGAAGTTCACAGAGATTTTGATGACCGCAGAAGACCCTG

GGAGAGGCAGAGGGATAGGGATGACAGAGATTTTGATTTCTGCAGAGAAATTAATGGAAATCGTCTTGGACGAGATAGAATTCAAAACACTTGGGTTCCC

CCTCCTCATGCTCGGGTTTTTGATTATTTCGAAGGGGCCACTTCTCAACGGAAAGGTGATAATGTGCCTCAAGTTAATGGTGAAAATACAGAGAGACATG

CTCAGCCACCGCCTTTACCAGTACAGAAGGACCCTGAACTCTATGAGAAACTGGCGTCTTCAGGTGACGTAGACAAGGAGGAGAGCGGCACAGTTGCTGG

TGTAGAGAGTGAAGCGGTGGTAGAAAGCACAGAGACTGAGGGGACATAACATCACTCAGTAGGTAAAAGAAACCTTTTGTACAGTTGTCATCTCTGTAAG

AGGTTAATGGCTGACTGCACCACACTTGTTCATGTTTATCTACCAGAACTAAGTTAATCTGATGTTCATGTTCACCTTTCTCTTAAAATAATTGTACAAC

TGACTTGTATAGACATTGTTCTTAATATGAACATGGTAGGTAAACACTTTTTTTTTCTGATAACGTATAAATGTTGCCCCAGATTCTTTTAACGTCAAGG

AGATGCTAACGGCTTGTCGGAGACTTCCTATGGAAGAGAAGGTTTTAGACGCTGTCATTGGGTTGGGTATGGCAATGACATATTTCAGAACAGCAAGGTG

TGGCCCATTTCCTCCATAACTCTAGGCTGCTGCAGGATTTTAAGGAGACAGACAAAGCTATGACATTTTATGCAAGGACTGGCTCTAGATTCTTGAGGAG

CATAATACAGAGATTTTAAAAAGTGATTTTGTAAAAATCTCCACGATGGTCTCTGTTACTCCAAAGTAAGTGTGTGTGATTTGTTCCTCATACTGCAATA

AGTAAAAAGAAAAAAGCAAACAACATAAACATTCAAAGACGTTTCAATGTTGGGTGAATTTTGTTTTTAGATGCCAATAAAACTTACTTGTTTG
Translation
MEAVKTFNSE - UNI1267 - LYSLNDYKPPISKAKMTQITKAAIKAIK - UNI36152 - FYKHVVQSVEKFIQK - UNI14525 - CKPEYK

VPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDK - UNI28324 - SKIVRVLNLWQKNNVFKSEIIQPLLDMAAGIPPPVVTP

VLASTTAAMSNTPG GTPVTPVTPANVVQGLPDPWVSQIANTDTLAAVAQILQSPQGQQ LQQLIQTLQIQQQKPQPSILQALDAGLVVQLQALTAQLTA

AAAAANTLTPLDQGVSFNK KLMDRFDFGEDSEHSEESKKEMPTPQL - UNI32063 - LSHVSESVNNSIFHQIAEQLQQQNLEQLRQQLLEQQQPQ

K VTPQDSQEGTFGSEHSASPSQGSSQQHFLEPEANLDDSIDIQQQ DMDIDEGQDVVEEEIFEPEAKKVAVRSRSRTHSRSRSR RSPRKRRSRSRSGS

RKRKHRKRSRSHSREKKRKASRSYSSERRAREREKERQKKGLPPVRSKTLSV - UNI157 - VCSTTLWVGQVDKKATQQDLTNLFEEFGQIESIN M

IPPRGCAYVCMVHRQDSFRALQKLSSGSYKIGSKVIK - UNI36623 - IAWALNKGVKTEYKQFWDVDLGVTYIPWEKVKVDDLDGFAEGGMIDQET

VNAE EWETVKASEPVKEPVQTAQSPAPVEKESVVTTQAEVFPPPVAMLQ IPVAPAVPAVSLVPPAFPVSMPVPPPGFNPIPPPPFLRASFNPSQPPPG

 - UNI31029 - GFMPPPVPPPVVPPPAIPPVVPTS - UNI9293 - SLVQPPLSMTPEAVKDVGFGSLVLPSGSVAGSLAPSTLPAGNVFNPPSK

AEPEEKVPHLIEHQIPSGENTRPV VIPSDIPSSAAMLAQPPGASSTSGILCVQRPNVSSNSEILGVRPANVSNSAAIMGAQPPNILNNSGILAIQPPNV

SSGSGLLGVLPPNLPNNSGLVGLQPPNVTSPAGLLGTQPPIGPQNLPPLAIPAQRMPALPMLDIRPGLIAQAPGPRFPLLQPGIPPQRGIPPPSVLDAAL

HPPPRGPFPPGDLFSQPERPFLAPGRPSIDNVPNPDKRIPLGNDNIQQEGDRDYRFPPIETREGITRPPQVDVRDVVGRRLDPREGPGRPPLDARDHFGR

PPVDMRENLVRPSLDHLGRRDHFGFPPEKPWGPRDFDEREHRVLPVFGGPKGLHEERGRFRAGNYRFDPRSGPWNRGFGQEVHRDFDDRRRPWERQRDRD

DRDFDFCREINGNRLGRDRIQNTWVPPPHARVFDYFEGATSQRKGDNVPQVNGENTERHAQPPPLPVQKDPELYEKLASSGDVDKEESGTVAGVESEAVV

ESTETEGT

For any suggestions or comments, please send an email to unitrap@crg.es