Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000046219 (C230012O17Rik)
Chromosomal location
Chr 4: 24887937 - 24894596 (-)
Description
RIKEN cDNA C230012O17 gene Gene [Source:MGI Symbol;Acc:MGI:2442283]
UniGene
Mm.472876 
MGI
MGI:2442283 
Uniprot/SPTREMBL
Q8C813 Q3U5A8 
Human Ortholog
not available
Omim not available
UniTrap UNI27209
Vector Insertion
Chr 4: 24890213 - 24893529
Public Clones not available
Private Clones OST66760 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108207
Sequence
ATGCTGAGTCTCAGCCTAGAGTGGAGAGCC GGGCGGGAAAGTTCCCGAGGGTCACAGCCCTCCGCGAGGTCTGCTCGGCGGAGCCCCGGCTGGAGCACC

GGGGATCAAGGAGGCCCGAAGCAGCGCAGGACATCGCGTGGCCCCGGGAAGCCGCGGCCGCGCCGGGAGCCTCTCCGGGTTGCCGGCTGCCGAGTCAGCC

GCTTCCTGCCGCGGGGTCCGGAGAGAGCCGCGCTCCGCGCCACCAGCCAGCCCGTCCGACCGACCGCCCGCCCGCCCGCCCGCCCAGGATGCGCTCGCCT

GCCAGGGAAGCGCTCACACCTCGCA AAAGGCGCCGCGGCGGGACGGCGGGGAGTAGGCGACCGCTGCCTCCCGGAACTTTGCGGACATCGCACCGCAGC

TCCACAGCTCCGAGCCCCCGGCGCAGGAGGAGGCCGAGGCGGCGGCGGAGAGTCGGGGCATCGCCCGGCAGTGCCTCCGCCTTGCCGGCTGCCGGCGGCT

CCCGCCCCCGGTTAACCAGCGCTCGCTCTTAAAGGCGCCCGCTGCTGGTTAGGCCGCGAG - UNI27209 - GTAAGTCGGCACATTGCTTTTGTGTG

GGGGCTAATGGAGGAGGATCGTGAGTTCTAGGACAGCTGGAGCAACATGCCAAGTCCCTGTCTCAAAGGAAGGAAAAGAAACCAGTTTCTACGTGTACCC

AAGGTTTACAGCATAGCGAGATACACATGGTAAGGCCTACAAATGGTTCTTCAAATTTGTAGATAAATTGAAATTTCTCAGCTCTGACTACACATTAGAA

TCACCATATAGCTTGCTAAAAGTAGCACCTGGGACCCACCCTCAGGGAAGCCAGACAGAAATGAAACGGAAGGTCCTCGGTGATTCTGATCGCCATGACT

GGGAGCCCCGGGATGTCCACACAGCAGAGTTCGTGTAGACCTGGGTGGGAAGCATGATGGTATGTGTGCTCTTTCTTCCATACGCACAATGATCCTGACT

GATCTTTCTGGATTCGCAGTGGTGCTATAGAGCATGGCAGGCAGGTGATAGACTTCTAACTGCTTTCTGCTCTGCCTTGCCCCTGAAACATTCCCAACTG

TGGTGGAGACTGCATGTGGTTTATCTCAGTCGGCAGCACAGCCTGATTCCTAAGTCATACTCTCTCCTGTGCCTTTCTGCACGCGCAATGTATAGGCAGT

CATCAGCACACGGCAGTCTCTGGACAAGTGAGAAGGGAAGAAAACACCACCGAAGAGTTCCTCAAGAAGAGGTCTAGAAGCAAGAAGCAAGTGGTTTTGG

ATCCCTGGATAATTAAAAAAAAAAAATCACTCATTAAATTTTAGCTATTTGGATTCTGACATTAGCATGGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTG

TATGTGTACTCATATTGCCCCTTCTAAATATAATAGTGATGTGCTTGTTGGAAATTGTATTAATATTAATTCCTCTTAAATGTGCATAACGGTATTAGTT

ACTTTTCTGCTGCTGTGCTAAAACACTTTAACCAGAAACAACTTAAGCAATTTTTGGTGGTGAGGAGGGGGCTATGGTTTCAGAGCGAGAGTCCATGTTG

CAGCAGAAAGCTGAAAGTCCACAGTCCACTTCAGAACAAGAGCAGAGAGGGCAAACTGGAAGTGGGCTAGCGCTGTAAACTCTCAAATTCCACCCCTAGT

GATGAACTTCCTCCAGGAAGGCTGCACCTCCTAAAATCCTATAACCCTCCCAAACAGTACTACTAACTGGAGACACATATTCAAATATATGAGCCTATGA

GGGACTGTGGACTTGCCCCAGCCAGCTAGGCTCAGTCTCCACTGATCAAAGGGAAGGGCAAATATCTGAGTGAGGTACCCAGAGGACTCAAGATTTTTGT

GCTCAAGACTAGCACAAAGCAGCCACTTCTTACTTTCATTATTACAGCAAGCAAAATATGAGGTGATGCTCATAGTGTAAGCAACTACAAGTATAGTTTG

CAATACACCTAGTGTTACATCTTATCATCTCGGCCTTGTGAAGTCTTGCCCACAGAGATGATGAGGACGTGCCAGGAAATTCCCTTTATGCCCTTGCTTT

CAAGTGAGCTTGTTTATCATAGTTTATGCATTTCTTTCTAAAAGGCCACCGTGTGAGAAGAACATCCTGCCCTTGGCCCATACATGGTTCACAGTAAGTT

CACACTGTTCTGCCAATCACATTGTGCCTAATGGCTGCTGCTTTGAGAACTGTATAAAGGCTCACCAGACAGGCTATGAGTGGTTGTTCTTTCTCCATGT

GCAGGGCAACCCAACATGTTGGAACAATAAATTCCTCTTGCTTTTTGCATTGATTCCCGGCTCTGTATCATTCACTCAGGGAGTCCCCAGTAAGCTAAGG

CTCACCAGAGTTTTACAGAACCAGCCTGTGTCCATCTTAGGCTTGAAAACCGTTTTACAAAAAGACAAACTAGATTCATTCCTCTTTATGATTAGATGTC

TGGTTTTCGGATTGGGCTACTATCTGTAACCTTAATTACAAATGTTTCCATACTGCCTGTTCCAGGAAACAGCAACAATGTCCTTGTTTCAGGAACTTGT

TAGACCATTTTGCAACCATGACCATCTTACAACCCTACCTTTGTTTCAAAGGGTTATTAGGGCTACCTTGTAATGACTACCTTGTTATGTCCTGTTTCTG

TAACACCACCCATTTGTGTGCCAAATTCTCTATTTGGAAACTCCCCACCCCTGAGCTATAAAAGCCTTTATCTTCCCCATGCCTGATTCTGACCTTTTGA

ACCCCACCTTAGTGGGAGATGGTCATGTAAATAAATAAAAAAGCTTGCTT
Translation
MLSLSLEWRA GRESSRGSQPSARSARRSPGWSTGDQGGPKQRRTSRGPGKPRPRREPLRVAGCRVSRFLPRGPERAALRATSQPVRPTARPPARPGCAR

LPGKRSHLA KGAAAGRRGVGDRCLPELCGHRTAAPQLRAPGAGGGRGGGGESGHRPAVPPPCRLPAAPAPG - UNI27209 - 
Transcript ENSMUST00000052917
Sequence
AGAATGCAGGAACTGAAGCCCGAAAG GCGAACATGCTGAGTCTCAGCCTAGAGTGGAGAGCCCAGGGCGGGAAAGTTCCCGAGGGTCACAGCCCTCCGC

GAGGTCTGCTCGGCGGAGCCCCGGCTGGAGCACCGGGGATCAAGGAGGCCCGAAGCAGCGCAGGACATCGCGTGGCCCCGGGAAGCCGCGGCCGCGCCGG

GAGCCTCTCCGGGTTGCCGGCTGCCGAGTCAGCCGCTTCCTGCCGCGGGGTCCGGAGAGAGCCGCGCTCCGCGCCACCAGCCAGCCCGTCCGACCGACCG

CCCGCCCGCCCGCCCGCCCAGGATGCGCTCGCCTGCCAGGGAAGCGCTCACACCTCGCACAAAAGGCGCCGCGGCGGGACGGCGGGGAGTAGGCGACCGC

TGCCTCCCGGAACTTTGCGGACATCGCACCGCAGCTCCACAGCTCCGAGCCCCCGGCGCAGGAGGAGGCCGAGGCGGCGGCGGAGAGTCGGGGCATCGCC

CGGCAGTGCCTCCGCCTTGCCGGCTGCCGGCGGCTCCCGCCCCCGGTTAACCAGCGCTCGCTCTTAAAGGCGCCCGCTGCTGGTTAGGCCGCGAGGTAAG

GAAGAGAGGAGTGGGGTGGAGGCAAGGAAAGGGGGAGGGGGCAGCTCAGACAGGCTCCCGGGAGTCTTCTGCAGTCTAAACTCAGACTCCTCTCGCTCCA

GGTCCCCAGGTCACCCCACCCCCTAAAACGGGAGTTAAGTGCTCAGACCCTACACCAAAGATGTGTAGCCACTGCTGGCTAGCTCAGGAAACCTCACATT

TGCTTGAACTGCCCACACCTCTGTTAAGATCTTTATCTTAACACCCCCCATCCCTGCCTGGGCCACACTTACCATAGAGCTAAAATCGGCGCCCAATGGG

ACCATGCTTCCCTCCGCTGATTGGGCAGCCTCCCGGGTGTTTCTTCATTTCCAACACTGTGAGGAGGGGCTCATCTGGAGCACTTCACATTGAAGACCAG

CTTGGACCCTTACCTGGACCGCTGAAGGAGTCGTGAACTATAGTGGCAGACATGCCTTGCTTTGACCCATGCTCACCTGCCCGGTGGCTTCCACCTGGAT

TGCTAGAACCACTGGCATTCATGATCACCAAACTGGACTCAGGAAGAACCTGAAGGAAAGATACCACCATCAAATCTCAGTTATGGTGCTTTTGAAATGT

TGCTTCCAAGTGATAAATGACACTTACTGTTTTCCTAACCATCGTCCACATTTATGGCAGAGTGGAGGGCCCAGGAGGCTCGGAGCACTAGCAGTTTTCC

TGACTCCACAGCAGACCAGCATCCAAAGCTGCTGTTGTATCTGTTGGTTTCAATCCTTGCTTCGCAGTCCTGTGGGACCACTCTAACGGAAATGGAAAGG

AAGATGTTAGGCAATTAGGGGGTATGATCCAGCCTGGGCTTCAAACATCAGTCCCAGCAAAGGACTCTGAAGGTATGAGTGACATTTTCTAATTCAAAGG

AGCTTGCACCTTTTAGCCCTGGCTTCAACCAACTTGGTTCTTACCCTTAGGCCACTGTGGAGTACACGGCTGCTTGCAAGAGGTAGAAGCAATTTGTGTT

ACCAGATGGAGAGAAACTAAGCTCCAGGCTTTGGAGAAAAGAAAGCGGGAGGGAGGGCAAGGAAGGGGAGGAGAAGGGAGGAGAGAAGAGGGGAGGAGGA

AAAGAAACAAGGAAGGCTCCGTCCTAGTGAAGAGAATCCATCATAAAGCAGTTGGGATGGCTGGATCTAATAACCAGGACTTAATCCAAAGGGACTTAAG

AAAATCTGTAGTGAAGGCTGTGTAATTTATCGGCTCCTATTTATAAAGACTAGTAATGACGTAGTCACCCCCTACCCCC
Translation
 MLSLSLEWRAQGGKVPEGHSPPRGLLGGAPAGAPGIKEARSSAGHRVAPGSRGRAGSLSGLPAAESAASCRGVRREPRSAPPASPSDRPPARPPAQDAL

ACQGSAHTSHKRRRGGTAGSRRPLPPGTLRTSHRSSTAPSPRRRRRPRRRRRVGASPGSASALPAAGGSRPRLTSARS

For any suggestions or comments, please send an email to unitrap@crg.es