Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000046280 (She)
Chromosomal location
Chr 3: 89635292 - 89662758 (+)
Description
src homology 2 domain-containing transforming protein E Gene [Source:MGI Symbol;Acc:MGI:1099462]
RefSeq_dna
NM_172530 
RefSeq_peptide
NP_766118.2 
UniGene
Mm.408053 Mm.225 
MGI
MGI:1099462 
Uniprot/SWISSPROT
Q8BSD5 
Uniprot/SPTREMBL
Q2VP88 
Human Ortholog
ENSG00000169291 (SHE)
Omim not available
UniTrap UNI20616
Vector Insertion
Chr 3: 89636026 - 89638065
Public Clones not available
Private Clones OST356884 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23288
Vector Insertion
Chr 3: 89638193 - 89653289
Public Clones IST12575A5 (tigm)
Private Clones OST266777 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25255
Vector Insertion
Chr 3: 89653596 - 89655530
Public Clones not available
Private Clones OST190103 (lexicon)
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27732
Vector Insertion
Chr 3: 89656409 - 89658452
Public Clones CMHD-GT_432H5-3 (cmhd)
Private Clones OST51191 (lexicon)
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107401
Sequence
ATGCGGCGGCCCCCGGCCCCTGGCGCCCCACGGTGTCTCAGCTGGGCCTCCTCACTCTTCTG CTCCTCTTCCTCTGCGTCCTCTTCCCCGTCCTCCCTG

GGCCCTGAGCTGGACAAGGCCAAGATAATGAGACAGCAAGACACG - UNI20616 - GTCATCATTTTAGAGGACTACGCTGACCCGTATGATGCCAA

ACGGACGAAAGGTCAAAGGGATGCGGAGAGAGTGGGTGAGAACGACGGCTACATGGAACCGTACGATGCACAACAGATGATAACAG - UNI23288 - 

AAATCAGACGCCGTGGTTCCAAAGATCCCCTGGTGAAGGCCCTCCAGTTGCTTGATGGCCCGAGTGAACCAGGGGAGACTGTGAAGGTGGAGGCCACAGC

CAAGAGACGCAGCTCCAAGGACCTGCTGGGGAAGCCGCCACAACTCTATGACACCCCGTACGAGCCTTCGGAGGGTGGCCAACGTGTGGCAGAGGTGAAG

ACGCGGCCAGCAGACAGCAGGCTACCAGAGGAGGATGATCGGCCCGCTGCTGAGTATGAACAGCCCTGGGAGTGGAAGAGGGAGCAGATCGCGAGAGCCC

TGTCAG - UNI25255 - TCCAGTTTGAGGGATCTGATCGACCTCCGGGCAGAGAGGATGCAGGGAGACCGCACCACTGGCAGAAGACCTTGAAGCCG

ACCCTGTCAGACCACGGTGATGGGGAGAAGGTGGACCCAGGCCTGGCCCTGGAAAAACAACC TTGGTATCACGGCTCCATCAGCCGAGCTGAGGCCGAG

AGCCGACTACAGCCCTGCAAAGAAGCCGCTTACCTGGTCCGGAACAGTGAGTCAGGGAACAGCAAGTATTCCATTGCACTGAA - UNI27732 - GAC

GAGTCAAGGGTGTGTCCACATCATAGTGGCTCAGACAAAAGACAACAAATACACACTGAACCAGACGAGCGCTGTGTTTGACAGCATCCCTGAAGTGGTA

CACTATTACTCCAATGCAAAGCTGCCTTTCAAAGGAGCAGAGCACATGACCCTTCTCCATCCAGTGCACAAGCTCCACTAAAGTCGGCCAGCAAGAGCCC

GGGCACCTGTGAGGCCTTCAGCACCCAACAACATCATGTGGACAGGACTCGCTGCTGCTGCTGCAGACCAGGAGTCGGCGCCTAGAAGTCAAGCGGTCTG

TGGTCTTAAATCCAGGACACAGTGGTTTCTGACCTGTTCTTTCTCTCCCTACTACAAGAAAGTATTGCTTGCCTGCCACCTTCTCCCTTGGGCTAGGAGT

TCTGTTTGGAGTGTGAGCCTTAGGAAGGTTAGATCCAGAGCCCAGGAGCACTGAGCTTAGCCCTTGGCTGTTCTCTGGCATGCCTGGCCTCTGCACAACA

GAGAACCCCTAGGCCTTTATGAGTGACTGCTAGGCTGGAAGATCCTGCCAGTGTGAGCCCTTTGTGAGGAAGTGGATGGACGGTGGGAAACAGGAACGAT

GGGCAGGAAAGCTGTCTTTCTCCACGTCCTGATGCAGCTGTGGCCTTCACACAGCATTCACAACCTGAGGACTTCACAAGAGTATTATTTGGTTGGCTCT

CCTAAGTACTTGCTTTCTCAATTTCTCTGGACATCTCTATCCTTCTGCAGTAAATCAGTGATATGAGCAGAAATTGGACGGAGGCCCCCAGATGAAAGTG

TTACCAGTGTAATCAAGAGGTGGCATCCTTTCTATAACTCTGATCGTTATTAAGTGCACTCCAAAGATTTGATTTCTGATTTAAAAAAAAAATTCTACAG

AGCTCAACACCTGTTTTGTTATTGGATAATTACATAGCACTCGAGACAGCCTTTTTCTTTGTGGTTTTTTTGTTTTTGTTTTTTTTTGTTTTTTTGCATG

AAATCATCTTTAAGATTCCTTTCTGAAATTAGATTTGCTTTGTAATTTTTGGCAAAAAATTTTTACAACAAAATTGGGATCCCATTGTATGAACTGAGTC

GCTGGTCTGAAAAGATTGCCCCTGATGTACAGACAGAACAAGCCAATATGTGCCTTACAGAAACATTTTGAACAATATTGTAGTCTGAGGCTGTCTCTTC

TGCTCTCTAGGACACTAAATCATCGCATGCTTATCCGTGATCTGTGTACTGTAGGGAATCCCACAGGAGGGGCACGCTGTGTGTAGGTGCTAGTGGGAAT

GGGCTGGACCAGAACCAGAGGAACATTTCGTGTTCAGGTTTATAAACTGGATCTCAAGACTGTTCCACCCTCAGTGGAAACTGAAGGTTTGTAGCTTCTC

AGATGCACAAAAAAATATTAACCATAAATTGGGTGTGGTGGCATACACCTTTAATCCCAGCACCCGGCAAAGGTAGGTGGGTCTTTGTGAGTTTAAGGTC

AGCCTGGTCTACAGAGTTGCAGGACAGCTAGGGCTGCACAGAGAAACCCTGTCTTGAAAATCTAAAACAACACAAAAACCACCACCAACAAAACATCTGG

TCAGATGTCTTAGGGAAGCATAGCCCCATCCTCGGCTCCCTCACCCGGCCATCCTGACTGAAATGTAGGAAGACTTTTGCTCCTGTGTCAGCGGACCTTA

GCCAAAGGGTTGTGCGAGATTTTGTTTTAAAAGGCTGAAAGGGACTTCTCCTCAGTGGAGCACAGTGGCCTGCACGAAGGCTGTTCTCACAGCACTGACA

ATCATTTTGGCTTCTATGTGTAGTGCAGGGCTCTCGGTTTAAGTTTTCAGTAGCCACAATTCCGCCCAGCAAATGTCAGTCATCATGTATTACCTTGTAT

CTGTGCATTGTTCACTGTGTTGAACCTAGTTTAGCTCAGCATTCTAGCCATGAAGCCTTATTTTTTTGCTTAGCCCTCCCTATTCAGCAAATGGAGCCGT

TGTCTTTAATGGTAAGAATATCATAAAATGTTTCTGGGTGGGGAAGGATTTGGGCACACGCCTCATGACTCTGATGAACACCGGCCTGGCAGGTCGGTGT

CACCTGGCCTCTGCCACACGCCTGAGCGTGCTCCCTCCATATTTGCTTTACATGAGTGAAAGTGGAGGAGACAGAGTTTATATATAGTCCAGTCTTCATG

GTAGGGCATGGGGCTATAAAAAGCAAAAATACTGTAGACTAGTGGAAGGCCAGTGAGGGAGATGTTAAAGCTGCTATTTTCTTCTTAGGTTGTGACACAA

GCTGACAGGAGCCAGGGGACTCACAGCTGGGTGGTAGCATAAAGTACCCTATCCTACCGTGCTAAAAACAATTAAGCGCAGCAGGGTGTCCTAACCACTC

ACTGGTGAGCCTGCCAGCTGGGGCTTGTCCTCCGAGCTCCAAAAGATTGAGCTTTTTGTCCTTTTCTTCCTGATAAAGGTATTTTCTTGTTATCTTTATT

CCTTTGAATTGATTCTGTCTGGGGGGGGGGTGTTTCTTCTGGTGAACCCTCAAGATGCTGTGAACATCTATAGCATCTAGAGAGCTGTCCACTTTTTCTC

CTTTAGCAAAACTTATTTGTAAAAAAACTGCTTTCTTTGTTCCAGAGTATGGACTTAGACAGGGACCCCTGAGAACGGAAGGCATCTGTAATCCATCCAG

CTGTCCAGGAGGTCCAAGAGTCCAAAACTAACCTTGGCAATAGAGCAAGGGTGTCTCCAAAAAGAATACAGGAAGGCAAAGGGCATTTCTACTTCCTGTA

ATAGCATAGCAGATTCTGTCCAGATGTATTCTAATCACTGTCTGAGGGGGCGCTGGCCAGTAGGATGTGCTGAGGAGGCAGAGACAGGAGGAGTTGAATT

AGAGGTTACTCTTGGGTTACACCTTGGGCCAAAGAAATGGCTCAGAGGTGGAAAATGCTGCACTTGTAGAAGACCCTGGTTAGTTCCAGTATCCACATGC

TGTCCAGGTCTAGGGGATCTGGCGCCCTCTTCTGGCTTCTGAGGGTACTGGGCAGGAACATGGTACACATACAAGCAAAACATTCATGCACATAAACTTT

TTAAAAACCTGAATGAAGGAATAGAAACAATGGAGGAAGTCTAGTGAGTATGCACAAAAGCAAGTGGTGGTAAAGAAACAGGTGTCCCTTCCGGTTACTG

AGAATGCTTTAATAGGCATCTGTAAGAACAGCCTGTATTGTTGGCCGTTTAGAGTCTGCGTCTGTGGTGCTGGAGTTCAGTCACTGGTCTCTGCCACAGG

AAGGGGAGCTGGGCAGAGAACCAGTAGGGAAAGCTGGCTCTTCTCAACACAGGTCCTACCTTAATAGTCCTTGTTTGGTGTTTAGATTATTTACCAGTGT

TGCCCCTGTTGGATAGGTCTTAATGTTTAATTCAAGAACAACTGTAAGTCATTCTTTGCTTACTAGATGAGTCTGTTAACATTTTCGTTAGGAGCTAATG

ACTTATTTTTCCTGGCCTCAGTCAAGAAGCCAGTGCATCTAGATTCATGCCCCCTGTACATGCTTCTGAAACTTAGGATTTCATTGCTCCCTTCCTGGGA

CCAGACAGCCATTGGTCGTCTTTCTGTCTTCTGTAGCCAGCACCCATTTAACCGTAAACTCCCTTGGGATCAATCTTTTGTCTTCTCTTTGCCACCTACA

TCCCACTAACTTGGCCTTGAAGAAACTTGACCTGTAAGAGCCTTCCCTGTAATTTAGCTTCCCGGCTTCATGGACCCTATGCAATGAAAGATGGTGTTCT

ACTGCCATCTACTGGGACAAGAAAAAAACTGCAGTTGAGAAACAAGGGTGCATTTAGGGTAGTTTGTCTCAAGGATTTTTGATACAGTCCATAAATCAAA

ATAAACGATGACACAGCAGTTGCCATCTTGAAATGTGCCCTTTACTGTAGAAAGGGTGTTTTGACTCCTAGTCTTCCCCTGGACCTAGGCTGGGTCATGT

TGTTCACAATTTTAATTCTATTTTTGAAGACTGCTCTGTCAACAGATCATTGAGGCAGGAATCATTCTGTTAAGCTCTTAGCTGTTCCAAATGCTGTCAG

GAGGATTTTACATTTAAAATATCAACTGATACGTCATTTTAACTTTTTAAAATATTTAAAAGGTTGTAATGCAGGTGCCTTGGCAATTGTTATTATAATG

GAATCTTATAAATTGTTGGCTCTCTTCACCGGTCAGCGTAGCTGTGTGCCTTCCGGAAGATGGTTTACCCTGAAGTGTTACTTTCAATAAATGCTTTGCC

AGG
Translation
MRRPPAPGAPRCLSWASSLFC CSSSSASSSPSSLGPELDKAKIMRQQDT - UNI20616 - VIILEDYADPYDAKRTKGQRDAERVGENDGYMEPYD

AQQMITE - UNI23288 - EIRRRGSKDPLVKALQLLDGPSEPGETVKVEATAKRRSSKDLLGKPPQLYDTPYEPSEGGQRVAEVKTRPADSRLPEED

DRPAAEYEQPWEWKREQIARALSV - UNI25255 - VQFEGSDRPPGREDAGRPHHWQKTLKPTLSDHGDGEKVDPGLALEKQP PWYHGSISRAEAE

SRLQPCKEAAYLVRNSESGNSKYSIALK - UNI27732 - KTSQGCVHIIVAQTKDNKYTLNQTSAVFDSIPEVVHYYSNAKLPFKGAEHMTLLHPVH

KLH
Transcript ENSMUST00000050401
Sequence
GGTGGAGCGCAGAGAACACGGCGGTCCGATCACTGCGCCCGTCTAGCTTCGGGCCGAGCGGGTGCCACCCTGCCAGGCGCGCGCGTCTAGCGGCCCGGAG

CCTCGCGGCGGCCTCCAGCGTCCAGCCCCGGGGAATGCGGCGGCCCCCGGCCCCTGGCGCCCCACGGTGTCTCAGCTGGGCCTCCTCACTCTTCTGCTCC

GCGGCCTCGACGCTCCCGGGCCCCCTGATGGCGGCGAAATGGTTCAAGGAGTTCCCGCTTACTCTGAAGACCGCGTCGGAGCGCGCCCGGCCCGGGGGCG

CCGGCGGCAAGCCGCGCAAGAACTCGGAGACTGGCGGCGCGGCGCCCACCCCGGGCAAGGGCCGGAAGAACTCAGCGGCCGAGCTGGGGGCCAGCAAGGC

GAGCAGCGGACCCCCAAAGGACAGTCGGCTGTCCCGGGACAGCCTGCAGGGTCTGATCCAGGCCGCTGCTGGCAAAGGCCGTAAGAACTCCCGGGTCACC

GCCACCGCCACCGAGGAGGAGCCCCACCGTGGCGCGGTGACCAAGAGCGCGGGCTGCAGCACCTACATCAGTAGGCTCATCAAGGTGGACACGCAGGAGA

AGAATGGGAAGAGCGCCTACCCGGGCGGTGGCAGCACCAGCAGCTCCAGCAGCTCCTCTTCCTCTGCGTCCTCTTCCCCGTCCTCCCTGGGCCCTGAGCT

GGACAAGGCCAAGATAATGAGACAGCAAGACACG - UNI20616 - GTCATCATTTTAGAGGACTACGCTGACCCGTATGATGCCAAACGGACGAAAG

GTCAAAGGGATGCGGAGAGAGTGGGTGAGAACGACGGCTACATGGAACCGTACGATGCACAACAGATGATAACAG - UNI23288 - AAATCAGACGC

CGTGGTTCCAAAGATCCCCTGGTGAAGGCCCTCCAGTTGCTTGATGGCCCGAGTGAACCAGGGGAGACTGTGAAGGTGGAGGCCACAGCCAAGAGACGCA

GCTCCAAGGACCTGCTGGGGAAGCCGCCACAACTCTATGACACCCCGTACGAGCCTTCGGAGGGTGGCCAACGTGTGGCAGAGGTGAAGACGCGGCCAGC

AGACAGCAGGCTACCAGAGGAGGATGATCGGCCCGCTGCTGAGTATGAACAGCCCTGGGAGTGGAAGAGGGAGCAGATCGCGAGAGCCCTGTCAG - UN

I25255 - TCCAGTTTGAGGGATCTGATCGACCTCCGGGCAGAGAGGATGCAGGGAGACCGCACCACTGGCAGAAGACCTTGAAGCCGACCCTGTCAGA

CCACGGTGATGGGGAGAAGGTGGACCCAGGCCTGGCCCTGGAAAAACAACC TTGGTATCACGGCTCCATCAGCCGAGCTGAGGCCGAGAGCCGACTACA

GCCCTGCAAAGAAGCCGCTTACCTGGTCCGGAACAGTGAGTCAGGGAACAGCAAGTATTCCATTGCACTGAA - UNI27732 - GACGAGTCAAGGGT

GTGTCCACATCATAGTGGCTCAGACAAAAGACAACAAATACACACTGAACCAGACGAGCGCTGTGTTTGACAGCATCCCTGAAGTGGTACACTATTACTC

CAATGCAAAGCTGCCTTTCAAAGGAGCAGAGCACATGACCCTTCTCCATCCAGTGCACAAGCTCCACTAAAGTCGGCCAGCAAGAGCCCGGGCACCTGTG

AGGCCTTCAGCACCCAACAACATCATGTGGACAGGACTCGCTGCTGCTGCTGCAGACCAGGAGTCGGCGCCTAGAAGTCAAGCGGTCTGTGGTCTTAAAT

CCAGGACACAGTGGTTTCTGACCTGTTCTTTCTCTCCCTACTACAAGAAAGTATTGCTTGCCTGCCACCTTCTCCCTTGGGCTAGGAGTTCTGTTTGGAG

TGTGAGCCTTAGGAAGGTTAGATCCAGAGCCCAGGAGCACTGAGCTTAGCCCTTGGCTGTTCTCTGGCATGCCTGGCCTCTGCACAACAGAGAACCCCTA

GGCCTTTATGAGTGACTGCTAGGCTGGAAGATCCTGCCAGTGTGAGCCCTTTGTGAGGAAGTGGATGGACGGTGGGAAACAGGAACGATGGGCAGGAAAG

CTGTCTTTCTCCACGTCCTGATGCAGCTGTGGCCTTCACACAGCATTCACAACCTGAGGACTTCACAAGAGTATTATTTGGTTGGCTCTCCTAAGTACTT

GCTTTCTCAATTTCTCTGGACATCTCTATCCTTCTGCAGTAAATCAGTGATATGAGCAGAAATTGGACGGAGGCCCCCAGATGAAAGTGTTACCAGTGTA

ATCAAGAGGTGGCATCCTTTCTATAACTCTGATCGTTATTAAGTGCACTCCAAAGATTTGATTTCTGATTTAAAAAAAAAATTCTACAGAGCTCAACACC

TGTTTTGTTATTGGATAATTACATAGCACTCGAGACAGCCTTTTTCTTTGTGGTTTTTTTGTTTTTGTTTTTTTTTGTTTTTTTGCATGAAATCATCTTT

AAGATTCCTTTCTGAAATTAGATTTGCTTTGTAATTTTTGGCAAAAAATTTTTACAACAAAATTGGGATCCCATTGTATGAACTGAGTCGCTGGTCTGAA

AAGATTGCCCCTGATGTACAGACAGAACAAGCCAATATGTGCCTTACAGAAACATTTTGAACAATATTGTAGTCTGAGGCTGTCTCTTCTGCTCTCTAGG

ACACTAAATCATCGCATGCTTATCCGTGATCTGTGTACTGTAGGGAATCCCACAGGAGGGGCACGCTGTGTGTAGGTGCTAGTGGGAATGGGCTGGACCA

GAACCAGAGGAACATTTCGTGTTCAGGTTTATAAACTGGATCTCAAGACTGTTCCACCCTCAGTGGAAACTGAAGGTTTGTAGCTTCTCAGATGCACAAA

AAAATATTAACCATAAATTGGGTGTGGTGGCATACACCTTTAATCCCAGCACCCGGCAAAGGTAGGTGGGTCTTTGTGAGTTTAAGGTCAGCCTGGTCTA

CAGAGTTGCAGGACAGCTAGGGCTGCACAGAGAAACCCTGTCTTGAAAATCTAAAACAACACAAAAACCACCACCAACAAAACATCTGGTCAGATGTCTT

AGGGAAGCATAGCCCCATCCTCGGCTCCCTCACCCGGCCATCCTGACTGAAATGTAGGAAGACTTTTGCTCCTGTGTCAGCGGACCTTAGCCAAAGGGTT

GTGCGAGATTTTGTTTTAAAAGGCTGAAAGGGACTTCTCCTCAGTGGAGCACAGTGGCCTGCACGAAGGCTGTTCTCACAGCACTGACAATCATTTTGGC

TTCTATGTGTAGTGCAGGGCTCTCGGTTTAAGTTTTCAGTAGCCACAATTCCGCCCAGCAAATGTCAGTCATCATGTATTACCTTGTATCTGTGCATTGT

TCACTGTGTTGAACCTAGTTTAGCTCAGCATTCTAGCCATGAAGCCTTATTTTTTTGCTTAGCCCTCCCTATTCAGCAAATGGAGCCGTTGTCTTTAATG

GTAAGAATATCATAAAATGTTTCTGGGTGGGGAAGGATTTGGGCACACGCCTCATGACTCTGATGAACACCGGCCTGGCAGGTCGGTGTCACCTGGCCTC

TGCCACACGCCTGAGCGTGCTCCCTCCATATTTGCTTTACATGAGTGAAAGTGGAGGAGACAGAGTTTATATATAGTCCAGTCTTCATGGTAGGGCATGG

GGCTATAAAAAGCAAAAATACTGTAGACTAGTGGAAGGCCAGTGAGGGAGATGTTAAAGCTGCTATTTTCTTCTTAGGTTGTGACACAAGCTGACAGGAG

CCAGGGGACTCACAGCTGGGTGGTAGCATAAAGTACCCTATCCTACCGTGCTAAAAACAATTAAGCGCAGCAGGGTGTCCTAACCACTCACTGGTGAGCC

TGCCAGCTGGGGCTTGTCCTCCGAGCTCCAAAAGATTGAGCTTTTTGTCCTTTTCTTCCTGATAAAGGTATTTTCTTGTTATCTTTATTCCTTTGAATTG

ATTCTGTCTGGGGGGGGGGTGTTTCTTCTGGTGAACCCTCAAGATGCTGTGAACATCTATAGCATCTAGAGAGCTGTCCACTTTTTCTCCTTTAGCAAAA

CTTATTTGTAAAAAAACTGCTTTCTTTGTTCCAGAGTATGGACTTAGACAGGGACCCCTGAGAACGGAAGGCATCTGTAATCCATCCAGCTGTCCAGGAG

GTCCAAGAGTCCAAAACTAACCTTGGCAATAGAGCAAGGGTGTCTCCAAAAAGAATACAGGAAGGCAAAGGGCATTTCTACTTCCTGTAATAGCATAGCA

GATTCTGTCCAGATGTATTCTAATCACTGTCTGAGGGGGCGCTGGCCAGTAGGATGTGCTGAGGAGGCAGAGACAGGAGGAGTTGAATTAGAGGTTACTC

TTGGGTTACACCTTGGGCCAAAGAAATGGCTCAGAGGTGGAAAATGCTGCACTTGTAGAAGACCCTGGTTAGTTCCAGTATCCACATGCTGTCCAGGTCT

AGGGGATCTGGCGCCCTCTTCTGGCTTCTGAGGGTACTGGGCAGGAACATGGTACACATACAAGCAAAACATTCATGCACATAAACTTTTTAAAAACCTG

AATGAAGGAATAGAAACAATGGAGGAAGTCTAGTGAGTATGCACAAAAGCAAGTGGTGGTAAAGAAACAGGTGTCCCTTCCGGTTACTGAGAATGCTTTA

ATAGGCATCTGTAAGAACAGCCTGTATTGTTGGCCGTTTAGAGTCTGCGTCTGTGGTGCTGGAGTTCAGTCACTGGTCTCTGCCACAGGAAGGGGAGCTG

GGCAGAGAACCAGTAGGGAAAGCTGGCTCTTCTCAACACAGGTCCTACCTTAATAGTCCTTGTTTGGTGTTTAGATTATTTACCAGTGTTGCCCCTGTTG

GATAGGTCTTAATGTTTAATTCAAGAACAACTGTAAGTCATTCTTTGCTTACTAGATGAGTCTGTTAACATTTTCGTTAGGAGCTAATGACTTATTTTTC

CTGGCCTCAGTCAAGAAGCCAGTGCATCTAGATTCATGCCCCCTGTACATGCTTCTGAAACTTAGGATTTCATTGCTCCCTTCCTGGGACCAGACAGCCA

TTGGTCGTCTTTCTGTCTTCTGTAGCCAGCACCCATTTAACCGTAAACTCCCTTGGGATCAATCTTTTGTCTTCTCTTTGCCACCTACATCCCACTAACT

TGGCCTTGAAGAAACTTGACCTGTAAGAGCCTTCCCTGTAATTTAGCTTCCCGGCTTCATGGACCCTATGCAATGAAAGATGGTGTTCTACTGCCATCTA

CTGGGACAAGAAAAAAACTGCAGTTGAGAAACAAGGGTGCATTTAGGGTAGTTTGTCTCAAGGATTTTTGATACAGTCCATAAATCAAAATAAACGATGA

CACAGCAGTTGCCATCTTGAAATGTGCCCTTTACTGTAGAAAGGGTGTTTTGACTCCTAGTCTTCCCCTGGACCTAGGCTGGGTCATGTTGTTCACAATT

TTAATTCTATTTTTGAAGACTGCTCTGTCAACAGATCATTGAGGCAGGAATCATTCTGTTAAGCTCTTAGCTGTTCCAAATGCTGTCAGGAGGATTTTAC

ATTTAAAATATCAACTGATACGTCATTTTAACTTTTTAAAATATTTAAAAGGTTGTAATGCAGGTGCCTTGGCAATTGTTATTATAATGGAATCTTATAA

ATTGTTGGCTCTCTTCACCGGTCAGCGTAGCTGTGTGCCTTCCGGAAGATGGTTTACCCTGAAGTGTTACTTTCAATAAATGCTTTGCCAGG
Translation
MRRPPAPGAPRCLSWASSLFCSAASTLPGPLMAAKWFKEFPLTLKTASERARPGGAGGKPRKNSETGGAAPTPGKGRKNSAAELGASKASSGPPKDSRLS

RDSLQGLIQAAAGKGRKNSRVTATATEEEPHRGAVTKSAGCSTYISRLIKVDTQEKNGKSAYPGGGSTSSSSSSSSSASSSPSSLGPELDKAKIMRQQDT

 - UNI20616 - VIILEDYADPYDAKRTKGQRDAERVGENDGYMEPYDAQQMITE - UNI23288 - EIRRRGSKDPLVKALQLLDGPSEPGETVK

VEATAKRRSSKDLLGKPPQLYDTPYEPSEGGQRVAEVKTRPADSRLPEEDDRPAAEYEQPWEWKREQIARALSV - UNI25255 - VQFEGSDRPPGR

EDAGRPHHWQKTLKPTLSDHGDGEKVDPGLALEKQP PWYHGSISRAEAESRLQPCKEAAYLVRNSESGNSKYSIALK - UNI27732 - KTSQGCVH

IIVAQTKDNKYTLNQTSAVFDSIPEVVHYYSNAKLPFKGAEHMTLLHPVHKLH

For any suggestions or comments, please send an email to unitrap@crg.es