Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000046449 (C77370)
Chromosomal location
Chr X: 101272773 - 101396524 (-)
Description
Uncharacterized protein KIAA2022  [Source:UniProtKB/Swiss-Prot;Acc:Q5DTT1]
RefSeq_peptide
NP_001070822.2 
UniGene
Mm.381907 
MGI
MGI:2148050 
Uniprot/SWISSPROT
Q5DTT1 
Uniprot/SPTREMBL
Q003Y7 Q003Y8 
Human Ortholog
ENSG00000050030 (KIAA2022)
Omim not available
UniTrap UNI30077
Vector Insertion
Chr X: 101294964 - 101396457
Public Clones (sanger) D124F10 (ggtc) D036F01 (ggtc) D093C09 (ggtc) IST14937G6 (tigm)
IST14346D11 (tigm) IST14959C1 (tigm) IST13606E11 (tigm) IST13609A6 (tigm)
IST14257G2 (tigm) IST14190C7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118314
Sequence
CAGTAGCATCAGCAGCAGCAGCCACCGCCGCCGCCACCACCACAGCAGTGGCAGTAGCGGCAGTGGCAGCGTTTAGCAGTAGTGTTCCCAGCGCTAGCGG

CAGTCGCAACCGCCCTCCGCGTCTCCGTCTCGCGGACAGCCGCAGCCACCGCGTGCAGAGCGGGCTCCGGGCACCGCCGCGCGCAGCCGGCGAGCCGGGC

AGTGCTGGCGCGGGCGAGCGGCGCGGTGAGAGGAGCGCTGTCCTGGGAGCCGGCGGGCGGCTGTGGAGCCTCTGAGTTTCGGCGCCCGAGCCCGACAGCT

CTGCCTCCATCTAGTGCGGCGGCTGCGGCGGAGCCAGAGTGAGCGAGCGGAGCGAGGCGCGTCCACCTGGCGGGCCCCGCGCATGGAGCAGAGGCAGAGG

AGACGGCAGTGAGCGGGAGCAGCGGCGGCAGCTCTAGCAGCTCCGGCGACGGCGACGGCGGCGGCAGCCCAGCCTTGACTGCGACCGTCCCAGCTCGGGA

CGCCGGCAGCAAGGACCCACCAGCGACGTGCGCCTCGGGAGGCGGCCTGCGAG - UNI30077 - GTTGGACAACATTTGAAATTGGAATGAAACAGT

AAGAGGCTACATTCATGGATAACCAACAAGATAAAGTTATTGCTGCCTCAGCCAATGGAGACAACAATCTGATTAATGGGGTCAAAAACAATG ACTCAG

AGGACCAGGAAGTGGCAATGAAGTCATTCGTAGCTCTAGAAGCTACTACTCCAATCCAGCCTATACCAGTGATACAAAAAGAGTCCCCGATGTTTCCCAG

GGGCCTTCTTCCTCCGCCATCTAAGAAGCCGTGTATGCAGAGCCCTCCATCTCCTTTGGCCCTGATTGAAGCACCCGATCATTCTGCTAATAGTGCTTCT

GTGAATGCCATCTCCCTCACATCTGGAGTTGCAAAAGGCCTGAACACATGGTCACTGCCCAACGAGTGTGAGAAAGCTCCATTTGCCATAATGGAACCTG

CAGGCATGTCAGCTCTGAACGGAGACTGCCTCATGCAGCCAAGCAGGACTTGCTTAGGTTGCTTCATGGAATCAAAAGAAGCAGTAGATCCTGAACCAGG

GATCAGTCTGAAAGTCAGTGATCTAAATCGAGATTATGAAACATGTGCAGTCTCTGACATAGGGATTCAATGCATTAATGCTGGGGAAAACATTAAGTAT

GGAGAGCAGCTGCTTTCAGACCAGCTGTTAGGCTTCCCCCTGCATAAGTCAAGGGCAGGAGATAGACGAGAATCTGAGAAACCTGACATCGACTTGGAAG

ATCCAACTCAGAAAAGTTATTATGAGGCATTACTATTAGATAAGTGCAACACGGAAGAAGCTTTGCTGGCAAATTCCAATCAGGATTGGGGTTACTTTGA

GACTTTTATTAGTGAGAGTAAGATTGAGCTACTTGACCTCTGTTCCAAGAATGAACTGTCTGTTAACCTTTTCTCTGAAGAAGATGTGGAGAACTATATG

TTCGATGATGATGAGTCAACCCTGGGCAGTGATGTCTGCTCCCTCAAAATTCGATATGAGTCCTTTCAGGACAATGTTCGAGACAAGACCACTCTTCTGA

TGCAGGAAGATGCCCAATTCAATTTTTTCCCCAGTGTCTTTACTACGTGTCCCAAGCGGGAATCTAAGAGTGGAATCCTCAAGCAGAGCAGTGATCTTTC

TCAATTCAAGGTCCCTGATGTGAGCATCATCTGGGGAGAAGAAGATAAAAACTTGGACAAGAAGAAAGGCAAAGAGGAAGTACATGAAGACAAAAGCATA

GAGACAAAAGATGAAAAAGATAATGGAGAAAAGCCTGCATTAAACAATAAACCATGTGGTGGTCTTGAGGTAGAGCAATTTAAGAACCTAAAGGCTGACC

AACTTACTAATTCCCTGGAGACATCAGGGAATTTCAGTGATGACAGTTCCTTCATTGAGGTCTCATATGATGCCATGGGGGAGATCAAAGACTGTAGCCG

CTATATGGCTCGGGACACTAATTCTGGAAGTTCATCCTCCCAGCAGAACTACGGACTGCGAGCCAAGAGAAAAGTCAGATACAGCGAAGATTATCTATAT

GATGTTGACTCGCTAGAGGGGGAAAAAGTAAATGAGAGAAAGGAATGGCCTCCAGGTGGTTCCAAAGAAGAAGATGATGATGAATGGTGTCCCAAAAAGA

GAAGAAAAGTAACACGTAAAGAGCCCCCTGTTATTATTAAATATATCATTATCAATCGTTTTAAAGGTGAGAAGAACATGTTGGTGAAGCTAAGTAAAGT

AGATGCCAGTGAAACAACAGTAAATCTGAGTGAGAATCAGCTCAGTAAGTATGCCAAGCTATCACCTTTGAAAGGATTCTGGCAAAAGAAGAAAAAGCAG

AAAAACAGCAACACAGACTCAGTCAAAACACCCTTATGCCAAAAGCAAAGCTTTGAACCAGGTAGCTTTGAGGTGTCATTCCTGCCTCCTGCTCGTAAAC

GAAAATCTAAGCTTGGCAACAGACACAGGATTCAAAGGATCCAATCTGTGGAAACTTCAGCAAGTAGTAAGCAGGTTTCATTCTGCAGTGATCAGAAACA

AGCTTGTAATCGCAAAGAAGACGGTGTAAAAGGGACACCAAAATCAGCACTTCTTACTGACCCAAGCTGTGCCAATGGATCACATTTACGTGGCCTCATA

GTCTCCGACTCGGTTAAAGTCAAAGCTCAAGATACAGAGTTCAAGGGCCCAGAGAGGAAAGTGCTTAACAAAATTAAATTTAAAAGTGAAGCTAGGTTAA

AATCCAAAAAAATCAAAGCTGGACAAGAAAACAAACCAGTTGTTCAAATGAGCCCTGTCTCAGAAGACACATCCTCCAAGGCTAATTTAAAAAATGAAGT

CACTCCTGGAACCTCAAACAGTTCCCATATGTCTGAATTTCACGAGACAAAAGTTAAGAATTCCACTTTCCTACCAACCACCTGCTCTTCTGAAATGCCT

CTATCATCTGCTAATGTTGCCACTAATATACCTGTTATTCCTGGAGGGTATCTGCAAACACTGTTAGATGCTTCTGACTTATCAAATAATACTAGTATCT

CATACTTCACCAACCATTCTGCAGAGCAAAATGAAGGCAGCCTCACTCAAACGGAAAAAGCATTTGTACCTCTCCAGTCTGCTCAAGACTGTGTGCTGTC

TTCATCTTCTGATTCTCAGCTGCAACAATCATCTCAGAACTTCAAAATGGAAGCAAGCAACTTTGGAAGTTTGTGGCCCGACAAGGATACATCTGGCTCC

CAGGAATTCATGACTGAAGTCTCAAGGGAGATAGCCACAAACCAATCTAGTGAATTTGAAGCTTCCCAAGTTGTCTCCATGGAGAATAACCTCACAGCTA

TAACATACAGTCCTGTATGCCTCAATAGTGATGCCAGTGGTTGCAACAAGGTTCTGTATGCCTCTTTGCAGGACTCACATCTCCCACCTGAAGACTTGTA

TCAATTGTGTCACTTTAATAATGGAGAGATCTGCTTTCCGTTCCAGCAGGGCCCACTCAGTACAGATGATGATGGCCGGCTCTTTAGCTTTGATTCGATG

ACTTCCCTTACTGTTAGTTCAAGCAATTATTGTTCCTTAAGCTTGAAATCCTGTGAAAAGGATGGTGATGATGAAATCAATGATGACTTTCTGGCCCACT

GCAGCCCCAAACTGGTGATCCAACAGAGCATTGATGAAATAGCACCACTAAAGGAGTCCACTGACCTCCTTGACATCTCCAACTTCACTCCTGACAAGTT

CCGACACTCTTCTCTCTTAGAAATGTCTCCCCCAGACACCCCCAGTCTTTCTCCTCAGAGTACCAGATGTGAGAGTATCAAAACACTAGGAACAATGAAA

GGATTCCAAGAAGGTGTCCCAGGATCGTTGAGCACCGTGGAAAAAATCAAGTGGGACTGTAATACCCTTTCACAACAGGCCCAAGCAGATGATGGCTTTA

CATTAAATAGCCATCAGTTTCAGTTCCATATGTTCAATGATGAGGACTCTGTTGGCCTGCTCCAAAAAAGCCCTTGCCTGTCAACATTTGATGAGCCAGC

TGGGCAAATTAATACCAACAGCAAAGTGTCAAAATCAAGAAAGAAAACTTCACCTGGCAAGAGTGGGGCTGTAAGCCAAAGTTCTTCTCAGAAAAATTCC

AGGAAAAAATCGCCAAAAGCAAGCAACAAAGGGGTTGAAAAGCCACCTAGCAAAACCTCCCGCCAGGTTCCTAAATCAACAAAGAAAGGGAAATATGTGG

CTGCTGTCAATGGAGAGAAAATGCAAATTGGGATTGGCCATAGTGGGGGCCAACCCAATAGTACATCCTCCAATGCAAAGACACTGACTGAATGTATTCA

GCATGGTGGTCCTGTTGCCTCTATGAAGATACCAAGTCAGAAGGGACTTTCTGGAGATTGGGCTTTGGGAAAGGAAAGCAGGCCAGGCTGGAATGACATG

AGTGTAGTCACTAATACCAACAACCTTCTGGATGATGACCAACGAGAGTTTCAAGAGCCTTCCTATATCTTATCCAATATTGCCTCTGGTATGGCAGATG

TGCAAAGATTCATGATGGCCTCCATGGAGCCCCTTTGGGAACCCATGGAGCACCAAGGGGAGTCCAACACATTCTACTCCCCTGATTCCAATAGCCTAAA

ATTAAAAACCCTCAAAATACTGGCTGGAACACCACAAGAATCTAAGAAAAAGGTTACTAATGGGTCTTCAGGAGCTACTAAGAATCACAGGTCAGTCAAA

GCTGTGAGCAAAAGCAACGGGAAAGCGGCAATTGGTGAGCCTGGTCATGCAGATATGCCTGGTTCCAGTGAGGACTCTCGATCTGCCTTCTTTGATAAAA

AGTACAGTAATGTGAACACTTTAGGCAATAATGGACCAACACACAAAAAATTATATCGTCACAAATCCAGCTCCAAGGGCCTGCGAGATGAGAAATATAA

GGGAAAGCGCGTGGAACGAGAACAGGCCCACAAGGATGAGGCTGGAACAACTTCTTTTGAAAAACTGAGGTAATACTGCACCAAAATGGCTCAGATGAGA

TGCGCCCTTGGCTTTCCTACTACCTGCTGAGCCCAGAGTTCCTATTTTTCCCTCTTGAAAGCGAAGTTTTGCATGAGAGACTCTTTCCCATTCTCCTCTT

TTTTTCAAATTAAAAAGAAAAGAAAAAAATGCATGGAAATCCCTGTACCTTTAAGCCACCCAAAATATTGGGCAATTTTATTGTGGCTTAGCTAGGGATA

AGTTCTAACAAAGGCTACATTTTTCTTCTATTCAGCGTTAATTTTTGCTTATTAAGGAAATAGAACTAAAACATGCTCTTGAATGATTTTTGGAATGGAA

GGGCTTTGCAATAAAGACAGATTCTGGACAACATATTCAAAAAGTCATGTAGACAAAAAGCCAAGATCATTTAAACAAAAGAGCATTAGTTGTCAGCACA

TGACAATTAGGAGTGCTTTCTCTACCTTTCTGCATCATACAACATCTAGTATGGTGTTAATATATTTACAGGGTATGATCCCTTCGTGGGACATACACTA

AAACTTACTAAGATGGCATAAATTCTTTGATTTTTCTGCAGGGATTCCAACTACAATCTCCTAAAAGCAGAAACAGCATTTGGGGTTTTACCTGTGTTTG

AAGAAGAGACTCACATTTTCCAGAAAGACATTTGATGTTTGTGTTTTCTTTCTTTCAAAATAAGCTTTGTGGTATGTATGTTGACCTGTAAGTGCTTACA

AGAAAAGAATTTTAAATCGTGGGAATAAGTCTTTGAAATCAAACTTTAATCTGATGTTCTGTGTAAAAGACTTTAAAAGTCATACAGTTGCACGAGTAGT

TTATGCACTGTTTGCCCACAAGGAAAAAAATGGAAAACTTTGTGCCAAACTACAAATAAGTAACTGTATTGTATATAGTTTTACTTCTATATCAACATTT

GGTTGTGAGTATTTGGGGGACTTGTCCCTGTTAATTTACTAGAAACATTCCAGTGATTCTTGCTATTAACCACCCCCACTTTTGTGGATAGCACCTATAG

ATCACAGTGGAAAATATGTTGTGTTATACAGTTTACCAAAACAAAGGATAATGTTTGAATTGTGCCAAATTTTCTTACTTCATCTCACAGATTCACCCCA

CAGTTTAAAACTCATTCATGATTATTAAATATATATATACATATACATCCATACATTCTTTTAATGTTTTAAACTCTACTATCCTGTGTGGAAATATGAA

CAGTTAAACAAGGCACAATAAAGATGTGTTTGTTCCATCATCTAAGGATTAAAATGTTGGAAAAGCTTAGGTCACAACAGCTAAGTCCATCAGGGACAGA

GTATACACATTTACAGAACCTTGCACAAGGAAATCAAACAGCTGCTTTGAAAGTTGGTTTTCCAAAGCAAAATCTGTAGCAGAAAAGAATTTAAAGTGCA

AAGTTATATTGCTGATACTTTATATCTCAGTTTTATATATTTTATAATAGCCTGGGATAAATTATAAAATAACTATAAAATTGACACTAATAATAAATAA

AATACATAGATTGCTTTTATTTAAGTAGTTTCCTAAATGTTTTATTCCAGTTATGTCAAAAGTGCACTCACAACATGGCTTTAGTGTTCTTTAAATGTTG

ATCTTGCAATGCCAATGTCATTTTTTAAAATGACATCTCAGATTGACAGAATTTTTCTTCCTATGATTAAATACATATACCACCAGGTAAAGCTGAACAA

TATGTGGAAATAACTAATTTAGGCCATCTACATATAGTCTGAGGATGACTACTCTTTTGATATCACACACTAAACATAAATCTCAATTTTTAATTACCTT

TTAAATTCATATTTTTGGTTCAACCCTCCCTTTCACTACTTAGAAACTTCACAGTTCCCACATTCCTCACTACTAGCCTTTTCTTCCCCTTTCTTCACCA

CTTGACTTATACCATTTGATCTCTTTTCCTTGCACAGTTAAGGCCTATGTGCCTAATGACTGATGCATTGTGGCACAGATGAGATAATGGATGTGAAAGC

GCTTTGTAGATCATAAAGTGCTATACCAATATAGGGGACTAATATTATTAATGTTGTTGGTTGTTGTTGTTGTTACTATTCTTACTAATATTGTTACTAA

CCTATTAACTTGTGAATATAGAGGCTGGGGTGGGAGGGAGGAGGATAAGGGGGTGGGAGAAGGGGACTTAATAAAACAGGGAAGATGTTTCAAAAGACAT

TTTTGAATAAAATATGAGCAACCTACCTAGTCATTGACACCTAAATATATTCACAAACAGAGAAGCAATGTTTTCAAGTAGTCAGAGAGAAATGGAAGGG

AGCCTATCATGTATATAAACATACACATTTCCCAGCCCATGATTCCTTTCACCAGCTTACTCTACTACTTACAGCTAGGTAGGAAAATGAACAAGCCCAT

GATCTAGATTGTGTGTGTTCTCAGCATCAGTCTCTTTTGTCTGTGGGGATGAGTGGGTGAGGAGAAATCTGTGAGGAGAGTTCAGGCACATTCCTAGGCT

TTGACACTGTGTTCAATGAGCCCTGGAAAATGATTTAGTGGGAAGGCACCAACTGAAACAAGTCTCTTGCCCTACAATGACCATCCAAAAGAGAAAATAA

TCAAACTAGAACACTTTCTTTTGTTTCTTGGTACTCTAATAGCTAGCTGTTTGTATTAAATGTGATGGCTACTTCCTAGGAACTGGTCTTTGTTCAGTTT

TGGTTTTTGTCTTGTTTTGCAGCTGACCTTTTGCTTAGAATCATCACCTCAGCCTGTATTGTGATCCCCAAGACTCCAGACCTCAAACTCATCTTGCTTG

GTTTTAGGAATGGAGTGCTTTCTATGTAACCAAAAAGTGGAAATTAAAGAAGAAATAAAGAAAATGTTCTATGAGTATAATGTGTTTTTATAAAAGTAAA

TATGGGAGCAGTTGTCCCAGATTTTTTTAAAGTATCATGATGTTCAGCTTTGGAGAATGGGGTAAGACTGGGGTAGGATAGCTTGAAACTGTTTCTAACA

GTTTCATTGTCAGAACTTGATCATCAGTCCTTTGGAGTGGATACTCTTTCAGTTGCTCCTATGGAGCCCACTAGGGGCCAATTTTAGGGCATGGTTCATA

TCTTTCTCCAAAGAGAACTGCCATTTTAAAGCACCTTTTTATCGGCCTGCCATGCATTGTATGTTCTTAACATATAAACTAGTGACTTGTAACCAGTCAT

TTTGTATTGAAACATAACAAGAAAGTGAATTTGAGGAGTGTGCAATAGACCAAGGCAGAGATGTTATTGTACACTATGCTCTACATTGTTGAGCACTTTG

CATTCTGTTGGTCCTGCCTCTGCTCTCAGAATTATTTTCCTTTCTGTCACAACATAGTAGGCCAAACTTACTGGAGATCTCTTATTCAACCAGCTGCCTT

AGTGGAGTGAGGACCAATGTATGAAAATAGTGTTTTGCCCTATCACTGATTTCTTCAACTCAAAAACCCTGGATTTTCCTTGATCTGAAATTTCTGACTA

CCCCCTTCTAACCTCTCCTTTCTGAGAAGCTGCATCCTATTAATGCCTCCTCATTGGAGTCTCATTTAATCTTTACTTTCCTGGAAATTATATCCTCCCT

TGTTCTTCTTTCTTGACTTTTATCAGTCTTAGAATTTTTCTTCTTGTGTAGTATTCTATTCAATATCCCAAACTGTCAAAGTTTAAGAACTACAGCTAGA

GGCTTTCTTTTGGAAGTTTAGAGGACTACCTTCCCTGTCTTATTCACTCAAAATACAAATGCACGAGCACATGCACACATAGCATTGAGAAAAGACTGAA

ACTGCTTTCTCTTGAAGGTGTGTGATAACAGGTCCAATCTCTTATTGTGGTCAGGTGCTGTACTACATGGAGCAGAGTGCAGATACAATGGCCCCAGCCA

AGGGTCTTCAAGACATTGAGGGTTGTGTTGGGACTAGAGTAAATAGCTTGAACCTGTGGCCATCCTCTATGCCTCTCCAGTGTCTCAGATCTCAGCTGCT

TCACATATGCTGCTCCCTCACAGCTTTCCCTACTGACTTCTTGCTGCTCTGTGCAATTATATGTTAAGGCCTTATCTTTTCCTATATCTTTTCAAACTTT

CTGCACTACTTCATTCATCACTTCTTTAGCCATCTCTCTGAAGTCCTTGGTGCTAGGTGGGCTTTTGTGACAAAAATTTTCACCTTCTCTGACTCTTTTC

TTTGCTGGGAAGAATCGTTGGGGGGTAGGGAACACAAAGGAGGGTATGTGTGTGTGTAAGAGAGAAGCATAAAGGATGCTTCAAATGCTGTAATCAACTC

CCATCCTGTGTTATTTCACGTGAGGTCTTGCAGTTCTAGTGAATTTCCATTTTAGTGGCTTTGAAATAGTGTTTACTGCGTAAAGGAGAAAAGCATATCC

AAGGACCTCTTTGCCTTGCTCTTACCAAACTGAACTAGTGTTTTGGAGATCTACAATTTATAGATGCACTCAGAACAGTTCTGAGAAATGAGGAGAGTTA

GAGTTGAGTTTCTATGCTGAAGAGGTAAATGGAACACTAGCTAGTCCTAGCTGTTGCTAGAACTAGAAATGTTTGTTTTCTCCTGTTTGACTGAAAGGTT

GTCAAATTATTCATTTTCATTTAGGGCTTTTAATGCTGCCAGTCATAACAGAAATATCTCCTTTTGTAAAATAAAACTAATGCAAGTTTTGTTTTTTAAT

CATAAAATTCTCTAAGCCAATATTATGTTTAGAAGGCTTAGTACCAAAATCAAACATTTTCATGACAAACAGAGATCTTGTCAACATAATGTAGGCCAGG

GATTTTATAGAGATTTCTCAAAGACCCGAGTTAAGGACAGAAATTAGTTGAGATGTTTAGTTTGGGAAACACTACTACCATCAGCTTAAGAGTCCTCAGC

CAGCATGGAGTTATTTTGGTGACTATGCAGGCTACCCTTTAAGACACAGTTTTCACTCAACATTAAACAGTAGCTACAGTCATGATGCAGAGATCCCATT

GCAGCTATATGATACTTGAGGTGTACTCTTGGTTTGAGAATCATAGCTAAATGCTAAAACACTGGGGAAAGACACTATAAGAGAGTGGCTTAGTGGAAAG

TTTTAAGGAATGAATGAGGCTTTTAAAAATCAGTGTTTGGGTAAATCAATACTAAATACACTAAAGAAACACTCACCCATACAATATGAAAAGGATGTCT

GTGTATCCAACAAGCTCAGGGTTCTCTGGGCCCACTGAAAATGAAGAAAGGTAACCAGGCATGGAGGCTCATGCCTGGAACCCTAGGCAGGATTGTTGGG

AGTTCCAGACCAGTCTGGTCTATAGTGTGAGACCCAGTCTGAAAAATAAAAATATAAAAGAAAGAAGGAGGATGAGGAAGGAAGGAAGAAATGAATGAAT

GAACAAATGAAAGAATCAAGGAAGGAAGGGAGGGAGGGAGGGAGGGAGGGAGGAAGGAGATACTGAAATCATTCTGCCTCTTTGAGAGATGCCTAGTTTT

ACAGCACAAAAGAAAAAGGCTTGAATGAAAACTAAAAGGGGCCTTTTTGTTTTTCACTCCCAGGGAGGTGGAGAGCTTCAGAGTCTCCACTGGGATAGCT

GTAGCACTGACTGGAGTTTGCTGCCTACAGAGTTTTGAATGTACTTACTAGACTTTAGTTTCCATAGAACTGAATGCACCTCTTCAGTAAGTGAAATGCT

TTATGGTGCTAAAGAAAATGATTATCCCCATTTTTCTTCTTCGCCAAGCCCCTTAAGCATTTAAGAAAATTTAAAGTAAAAGCATTTAGAGACCCTTTTT

ATGAATGTAACCTGTTTCTGTTTGACACATGACACTGCAACTTTAAAGTTAGGAAATTATTTGCCTTTTTCTTTTAGAATTAAGCTTTATAAATAATCTG

TAGAGTCAATTGAAGTATAAAGCTTAAGGATCACTCTTAAGACGCCTACAAAATCTTGTATATTTTTAAGTGTGCCAATTTGTAACATATTTTGTAAGTG

TATATTTTTCTTAGAAAAGTGCTGTGAAGTGTCTGTATGTGAGAGTTTTCCTTTTTTCTGCACCACTATGTGCTAATAAAAGGATATTTACTTCAAAGTT

TCTGGTTTTAGAAACCACAATACAAAGAAAAAACACTTTTGTTGGGAATTTTGTAACAAAAAATATGTTGTGAAAGAGTGTAGTGATCTTGTGCAAAGAA

AATGAACATTTGTGAGCTTCTTGCTGTTTTATAGAATTTCTTGTAAATTATTCTTGTAACACCTCTGGTTTTGTTGTTCTTGTTGAAAAAAGTTTTAAAT

ATTTGTGACTGAATGTATGGTGAAACTGTCATAATGTTACCTAGCTGAGTTTTGTTATTGTTTATGGAATAAATAAAAGAAAAGTTTAAAA
Translation
 - UNI30077 - MDNQQDKVIAASANGDNNLINGVKNND DSEDQEVAMKSFVALEATTPIQPIPVIQKESPMFPRGLLPPPSKKPCMQSPPSPLALI

EAPDHSANSASVNAISLTSGVAKGLNTWSLPNECEKAPFAIMEPAGMSALNGDCLMQPSRTCLGCFMESKEAVDPEPGISLKVSDLNRDYETCAVSDIGI

QCINAGENIKYGEQLLSDQLLGFPLHKSRAGDRRESEKPDIDLEDPTQKSYYEALLLDKCNTEEALLANSNQDWGYFETFISESKIELLDLCSKNELSVN

LFSEEDVENYMFDDDESTLGSDVCSLKIRYESFQDNVRDKTTLLMQEDAQFNFFPSVFTTCPKRESKSGILKQSSDLSQFKVPDVSIIWGEEDKNLDKKK

GKEEVHEDKSIETKDEKDNGEKPALNNKPCGGLEVEQFKNLKADQLTNSLETSGNFSDDSSFIEVSYDAMGEIKDCSRYMARDTNSGSSSSQQNYGLRAK

RKVRYSEDYLYDVDSLEGEKVNERKEWPPGGSKEEDDDEWCPKKRRKVTRKEPPVIIKYIIINRFKGEKNMLVKLSKVDASETTVNLSENQLSKYAKLSP

LKGFWQKKKKQKNSNTDSVKTPLCQKQSFEPGSFEVSFLPPARKRKSKLGNRHRIQRIQSVETSASSKQVSFCSDQKQACNRKEDGVKGTPKSALLTDPS

CANGSHLRGLIVSDSVKVKAQDTEFKGPERKVLNKIKFKSEARLKSKKIKAGQENKPVVQMSPVSEDTSSKANLKNEVTPGTSNSSHMSEFHETKVKNST

FLPTTCSSEMPLSSANVATNIPVIPGGYLQTLLDASDLSNNTSISYFTNHSAEQNEGSLTQTEKAFVPLQSAQDCVLSSSSDSQLQQSSQNFKMEASNFG

SLWPDKDTSGSQEFMTEVSREIATNQSSEFEASQVVSMENNLTAITYSPVCLNSDASGCNKVLYASLQDSHLPPEDLYQLCHFNNGEICFPFQQGPLSTD

DDGRLFSFDSMTSLTVSSSNYCSLSLKSCEKDGDDEINDDFLAHCSPKLVIQQSIDEIAPLKESTDLLDISNFTPDKFRHSSLLEMSPPDTPSLSPQSTR

CESIKTLGTMKGFQEGVPGSLSTVEKIKWDCNTLSQQAQADDGFTLNSHQFQFHMFNDEDSVGLLQKSPCLSTFDEPAGQINTNSKVSKSRKKTSPGKSG

AVSQSSSQKNSRKKSPKASNKGVEKPPSKTSRQVPKSTKKGKYVAAVNGEKMQIGIGHSGGQPNSTSSNAKTLTECIQHGGPVASMKIPSQKGLSGDWAL

GKESRPGWNDMSVVTNTNNLLDDDQREFQEPSYILSNIASGMADVQRFMMASMEPLWEPMEHQGESNTFYSPDSNSLKLKTLKILAGTPQESKKKVTNGS

SGATKNHRSVKAVSKSNGKAAIGEPGHADMPGSSEDSRSAFFDKKYSNVNTLGNNGPTHKKLYRHKSSSKGLRDEKYKGKRVEREQAHKDEAGTTSFEKL

R
Transcript ENSMUST00000087879
Sequence
GCGTTTAGCAGTAGTGTTCCCAGCGCTAGCGGCAGTCGCAACCGCCCTCCGCGTCTCCGTCTCGCGGACAGCCGCAGCCACCGCGTGCAGAGCGGGCTCC

GGGCACCGCCGCGCGCAGCCGGCGAGCCGGGCAGTGCTGGCGCGGGCGAGCGGCGCGGTGAGAGGAGCGCTGTCCTGGGAGCCGGCGGGCGGCTGTGGAG

CCTCTGAGTTTCGGCGCCCGAGCCCGACAGCTCTGCCTCCATCTAGTGCGGCGGCTGCGGCGGAGCCAGAGTGAGCGAGCGGAGCGAGGCGCGTCCACCT

GGCGGGCCCCGCGCATGGAGCAGAGGCAGAGGAGACGGCAGTGAGCGGGAGCAGCGGCGGCAGCTCTAGCAGCTCCGGCGACGGCGACGGCGGCGGCAGC

CCAGCCTTGACTGCGACCGTCCCAGCTCGGGACGCCGGCAGCAAGGACCCACCAGCGACGTGCGCCTCGGGAGGCGGCCTGCGAG - UNI30077 - G

TGCTCTGCAAGCTGAGAACTGACTTCAGTCTCCTCTACTTTTTTATTAGTTTCCT - UNI30077 - GTTGGACAACATTTGAAATTGGAATGAAACA

GTAAGAGGCTACATTCATGGATAACCAACAAGATAAAGTTATTGCTGCCTCAGCCAATGGAGACAACAATCTGATTAATGGGGTCAAAAACAATG ACTC

AGAGGACCAGGAAGTGGCAATGAAGTCATTCGTAGCTCTAGAAGCTACTACTCCAATCCAGCCTATACCAGTGATACAAAAAGAGTCCCCGATGTTTCCC

AGGGGCCTTCTTCCTCCGCCATCTAAGAAGCCGTGTATGCAGAGCCCTCCATCTCCTTTGGCCCTGATTGAAGCACCCGATCATTCTGCTAATAGTGCTT

CTGTGAATGCCATCTCCCTCACATCTGGAGTTGCAAAAGGCCTGAACACATGGTCACTGCCCAACGAGTGTGAGAAAGCTCCATTTGCCATAATGGAACC

TGCAGGCATGTCAGCTCTGAACGGAGACTGCCTCATGCAGCCAAGCAGGACTTGCTTAGGTTGCTTCATGGAATCAAAAGAAGCAGTAGATCCTGAACCA

GGGATCAGTCTGAAAGTCAGTGATCTAAATCGAGATTATGAAACATGTGCAGTCTCTGACATAGGGATTCAATGCATTAATGCTGGGGAAAACATTAAGT

ATGGAGAGCAGCTGCTTTCAGACCAGCTGTTAGGCTTCCCCCTGCATAAGTCAAGGGCAGGAGATAGACGAGAATCTGAGAAACCTGACATCGACTTGGA

AGATCCAACTCAGAAAAGTTATTATGAGGCATTACTATTAGATAAGTGCAACACGGAAGAAGCTTTGCTGGCAAATTCCAATCAGGATTGGGGTTACTTT

GAGACTTTTATTAGTGAGAGTAAGATTGAGCTACTTGACCTCTGTTCCAAGAATGAACTGTCTGTTAACCTTTTCTCTGAAGAAGATGTGGAGAACTATA

TGTTCGATGATGATGAGTCAACCCTGGGCAGTGATGTCTGCTCCCTCAAAATTCGATATGAGTCCTTTCAGGACAATGTTCGAGACAAGACCACTCTTCT

GATGCAGGAAGATGCCCAATTCAATTTTTTCCCCAGTGTCTTTACTACGTGTCCCAAGCGGGAATCTAAGAGTGGAATCCTCAAGCAGAGCAGTGATCTT

TCTCAATTCAAGGTCCCTGATGTGAGCATCATCTGGGGAGAAGAAGATAAAAACTTGGACAAGAAGAAAGGCAAAGAGGAAGTACATGAAGACAAAAGCA

TAGAGACAAAAGATGAAAAAGATAATGGAGAAAAGCCTGCATTAAACAATAAACCATGTGGTGGTCTTGAGGTAGAGCAATTTAAGAACCTAAAGGCTGA

CCAACTTACTAATTCCCTGGAGACATCAGGGAATTTCAGTGATGACAGTTCCTTCATTGAGGTCTCATATGATGCCATGGGGGAGATCAAAGACTGTAGC

CGCTATATGGCTCGGGACACTAATTCTGGAAGTTCATCCTCCCAGCAGAACTACGGACTGCGAGCCAAGAGAAAAGTCAGATACAGCGAAGATTATCTAT

ATGATGTTGACTCGCTAGAGGGGGAAAAAGTAAATGAGAGAAAGGAATGGCCTCCAGGTGGTTCCAAAGAAGAAGATGATGATGAATGGTGTCCCAAAAA

GAGAAGAAAAGTAACACGTAAAGAGCCCCCTGTTATTATTAAATATATCATTATCAATCGTTTTAAAGGTGAGAAGAACATGTTGGTGAAGCTAAGTAAA

GTAGATGCCAGTGAAACAACAGTAAATCTGAGTGAGAATCAGCTCAGTAAGTATGCCAAGCTATCACCTTTGAAAGGATTCTGGCAAAAGAAGAAAAAGC

AGAAAAACAGCAACACAGACTCAGTCAAAACACCCTTATGCCAAAAGCAAAGCTTTGAACCAGGTAGCTTTGAGGTGTCATTCCTGCCTCCTGCTCGTAA

ACGAAAATCTAAGCTTGGCAACAGACACAGGATTCAAAGGATCCAATCTGTGGAAACTTCAGCAAGTAGTAAGCAGGTTTCATTCTGCAGTGATCAGAAA

CAAGCTTGTAATCGCAAAGAAGACGGTGTAAAAGGGACACCAAAATCAGCACTTCTTACTGACCCAAGCTGTGCCAATGGATCACATTTACGTGGCCTCA

TAGTCTCCGACTCGGTTAAAGTCAAAGCTCAAGATACAGAGTTCAAGGGCCCAGAGAGGAAAGTGCTTAACAAAATTAAATTTAAAAGTGAAGCTAGGTT

AAAATCCAAAAAAATCAAAGCTGGACAAGAAAACAAACCAGTTGTTCAAATGAGCCCTGTCTCAGAAGACACATCCTCCAAGGCTAATTTAAAAAATGAA

GTCACTCCTGGAACCTCAAACAGTTCCCATATGTCTGAATTTCACGAGACAAAAGTTAAGAATTCCACTTTCCTACCAACCACCTGCTCTTCTGAAATGC

CTCTATCATCTGCTAATGTTGCCACTAATATACCTGTTATTCCTGGAGGGTATCTGCAAACACTGTTAGATGCTTCTGACTTATCAAATAATACTAGTAT

CTCATACTTCACCAACCATTCTGCAGAGCAAAATGAAGGCAGCCTCACTCAAACGGAAAAAGCATTTGTACCTCTCCAGTCTGCTCAAGACTGTGTGCTG

TCTTCATCTTCTGATTCTCAGCTGCAACAATCATCTCAGAACTTCAAAATGGAAGCAAGCAACTTTGGAAGTTTGTGGCCCGACAAGGATACATCTGGCT

CCCAGGAATTCATGACTGAAGTCTCAAGGGAGATAGCCACAAACCAATCTAGTGAATTTGAAGCTTCCCAAGTTGTCTCCATGGAGAATAACCTCACAGC

TATAACATACAGTCCTGTATGCCTCAATAGTGATGCCAGTGGTTGCAACAAGGTTCTGTATGCCTCTTTGCAGGACTCACATCTCCCACCTGAAGACTTG

TATCAATTGTGTCACTTTAATAATGGAGAGATCTGCTTTCCGTTCCAGCAGGGCCCACTCAGTACAGATGATGATGGCCGGCTCTTTAGCTTTGATTCGA

TGACTTCCCTTACTGTTAGTTCAAGCAATTATTGTTCCTTAAGCTTGAAATCCTGTGAAAAGGATGGTGATGATGAAATCAATGATGACTTTCTGGCCCA

CTGCAGCCCCAAACTGGTGATCCAACAGAGCATTGATGAAATAGCACCACTAAAGGAGTCCACTGACCTCCTTGACATCTCCAACTTCACTCCTGACAAG

TTCCGACACTCTTCTCTCTTAGAAATGTCTCCCCCAGACACCCCCAGTCTTTCTCCTCAGAGTACCAGATGTGAGAGTATCAAAACACTAGGAACAATGA

AAGGATTCCAAGAAGGTGTCCCAGGATCGTTGAGCACCGTGGAAAAAATCAAGTGGGACTGTAATACCCTTTCACAACAGGCCCAAGCAGATGATGGCTT

TACATTAAATAGCCATCAGTTTCAGTTCCATATGTTCAATGATGAGGACTCTGTTGGCCTGCTCCAAAAAAGCCCTTGCCTGTCAACATTTGATGAGCCA

GCTGGGCAAATTAATACCAACAGCAAAGTGTCAAAATCAAGAAAGAAAACTTCACCTGGCAAGAGTGGGGCTGTAAGCCAAAGTTCTTCTCAGAAAAATT

CCAGGAAAAAATCGCCAAAAGCAAGCAACAAAGGGGTTGAAAAGCCACCTAGCAAAACCTCCCGCCAGGTTCCTAAATCAACAAAGAAAGGGAAATATGT

GGCTGCTGTCAATGGAGAGAAAATGCAAATTGGGATTGGCCATAGTGGGGGCCAACCCAATAGTACATCCTCCAATGCAAAGACACTGACTGAATGTATT

CAGCATGGTGGTCCTGTTGCCTCTATGAAGATACCAAGTCAGAAGGGACTTTCTGGAGATTGGGCTTTGGGAAAGGAAAGCAGGCCAGGCTGGAATGACA

TGAGTGTAGTCACTAATACCAACAACCTTCTGGATGATGACCAACGAGAGTTTCAAGAGCCTTCCTATATCTTATCCAATATTGCCTCTGGTATGGCAGA

TGTGCAAAGATTCATGATGGCCTCCATGGAGCCCCTTTGGGAACCCATGGAGCACCAAGGGGAGTCCAACACATTCTACTCCCCTGATTCCAATAGCCTA

AAATTAAAAACCCTCAAAATACTGGCTGGAACACCACAAGAATCTAAGAAAAAGGTTACTAATGGGTCTTCAGGAGCTACTAAGAATCACAGGTCAGTCA

AAGCTGTGAGCAAAAGCAACGGGAAAGCGGCAATTGGTGAGCCTGGTCATGCAGATATGCCTGGTTCCAGTGAGGACTCTCGATCTGCCTTCTTTGATAA

AAAGTACAGTAATGTGAACACTTTAGGCAATAATGGACCAACACACAAAAAATTATATCGTCACAAATCCAGCTCCAAGGGCCTGCGAGATGAGAAATAT

AAGGGAAAGCGCGTGGAACGAGAACAGGCCCACAAGGATGAGGCTGGAACAACTTCTTTTGAAAAACTGAG GGATTCCAACTACAATCTCCTAAAAGCA

GAAACAGCATTTGGGGTTTTACCTGTGTTTGAAGAAGAGACTCACATTTTCCAGAAAGACATTTGA
Translation
 - UNI30077 -  - UNI30077 - MDNQQDKVIAASANGDNNLINGVKNND DSEDQEVAMKSFVALEATTPIQPIPVIQKESPMFPRGLLPPPSK

KPCMQSPPSPLALIEAPDHSANSASVNAISLTSGVAKGLNTWSLPNECEKAPFAIMEPAGMSALNGDCLMQPSRTCLGCFMESKEAVDPEPGISLKVSDL

NRDYETCAVSDIGIQCINAGENIKYGEQLLSDQLLGFPLHKSRAGDRRESEKPDIDLEDPTQKSYYEALLLDKCNTEEALLANSNQDWGYFETFISESKI

ELLDLCSKNELSVNLFSEEDVENYMFDDDESTLGSDVCSLKIRYESFQDNVRDKTTLLMQEDAQFNFFPSVFTTCPKRESKSGILKQSSDLSQFKVPDVS

IIWGEEDKNLDKKKGKEEVHEDKSIETKDEKDNGEKPALNNKPCGGLEVEQFKNLKADQLTNSLETSGNFSDDSSFIEVSYDAMGEIKDCSRYMARDTNS

GSSSSQQNYGLRAKRKVRYSEDYLYDVDSLEGEKVNERKEWPPGGSKEEDDDEWCPKKRRKVTRKEPPVIIKYIIINRFKGEKNMLVKLSKVDASETTVN

LSENQLSKYAKLSPLKGFWQKKKKQKNSNTDSVKTPLCQKQSFEPGSFEVSFLPPARKRKSKLGNRHRIQRIQSVETSASSKQVSFCSDQKQACNRKEDG

VKGTPKSALLTDPSCANGSHLRGLIVSDSVKVKAQDTEFKGPERKVLNKIKFKSEARLKSKKIKAGQENKPVVQMSPVSEDTSSKANLKNEVTPGTSNSS

HMSEFHETKVKNSTFLPTTCSSEMPLSSANVATNIPVIPGGYLQTLLDASDLSNNTSISYFTNHSAEQNEGSLTQTEKAFVPLQSAQDCVLSSSSDSQLQ

QSSQNFKMEASNFGSLWPDKDTSGSQEFMTEVSREIATNQSSEFEASQVVSMENNLTAITYSPVCLNSDASGCNKVLYASLQDSHLPPEDLYQLCHFNNG

EICFPFQQGPLSTDDDGRLFSFDSMTSLTVSSSNYCSLSLKSCEKDGDDEINDDFLAHCSPKLVIQQSIDEIAPLKESTDLLDISNFTPDKFRHSSLLEM

SPPDTPSLSPQSTRCESIKTLGTMKGFQEGVPGSLSTVEKIKWDCNTLSQQAQADDGFTLNSHQFQFHMFNDEDSVGLLQKSPCLSTFDEPAGQINTNSK

VSKSRKKTSPGKSGAVSQSSSQKNSRKKSPKASNKGVEKPPSKTSRQVPKSTKKGKYVAAVNGEKMQIGIGHSGGQPNSTSSNAKTLTECIQHGGPVASM

KIPSQKGLSGDWALGKESRPGWNDMSVVTNTNNLLDDDQREFQEPSYILSNIASGMADVQRFMMASMEPLWEPMEHQGESNTFYSPDSNSLKLKTLKILA

GTPQESKKKVTNGSSGATKNHRSVKAVSKSNGKAAIGEPGHADMPGSSEDSRSAFFDKKYSNVNTLGNNGPTHKKLYRHKSSSKGLRDEKYKGKRVEREQ

AHKDEAGTTSFEKLR RDSNYNLLKAETAFGVLPVFEEETHIFQKDI
Transcript ENSMUST00000056502
Sequence
GCGTTTAGCAGTAGTGTTCCCAGCGCTAGCGGCAGTCGCAACCGCCCTCCGCGTCTCCGTCTCGCGGACAGCCGCAGCCACCGCGTGCAGAGCGGGCTCC

GGGCACCGCCGCGCGCAGCCGGCGAGCCGGGCAGTGCTGGCGCGGGCGAGCGGCGCGGTGAGAGGAGCGCTGTCCTGGGAGCCGGCGGGCGGCTGTGGAG

CCTCTGAGTTTCGGCGCCCGAGCCCGACAGCTCTGCCTCCATCTAGTGCGGCGGCTGCGGCGGAGCCAGAGTGAGCGAGCGGAGCGAGGCGCGTCCACCT

GGCGGGCCCCGCGCATGGAGCAGAGGCAGAGGAGACGGCAGTGAGCGGGAGCAGCGGCGGCAGCTCTAGCAGCTCCGGCGACGGCGACGGCGGCGGCAGC

CCAGCCTTGACTGCGACCGTCCCAGCTCGGGACGCCGGCAGCAAGGACCCACCAGCGACGTGCGCCTCGGGAGGCGGCCTGCGAG - UNI30077 - G

TGCTCTGCAAGCTGAGAACTGACTTCAGTCTCCTCTACTTTTTTATTAGTTTCCT - UNI30077 - GTTGGACAACATTTGAAATTGGAATGAAACA

GTAAGAGGCTACATTCATGGATAACCAACAAGATAAAGTTATTGCTGCCTCAGCCAATGGAGACAACAATCTGATTAATGGGGTCAAAAACAATG ACTC

AGAGGACCAGGAAGTGGCAATGAAGTCATTCGTAGCTCTAGAAGCTACTACTCCAATCCAGCCTATACCAGTGATACAAAAAGAGTCCCCGATGTTTCCC

AGGGGCCTTCTTCCTCCGCCATCTAAGAAGCCGTGTATGCAGAGCCCTCCATCTCCTTTGGCCCTGATTGAAGCACCCGATCATTCTGCTAATAGTGCTT

CTGTGAATGCCATCTCCCTCACATCTGGAGTTGCAAAAGGCCTGAACACATGGTCACTGCCCAACGAGTGTGAGAAAGCTCCATTTGCCATAATGGAACC

TGCAGGCATGTCAGCTCTGAACGGAGACTGCCTCATGCAGCCAAGCAGGACTTGCTTAGGTTGCTTCATGGAATCAAAAGAAGCAGTAGATCCTGAACCA

GGGATCAGTCTGAAAGTCAGTGATCTAAATCGAGATTATGAAACATGTGCAGTCTCTGACATAGGGATTCAATGCATTAATGCTGGGGAAAACATTAAGT

ATGGAGAGCAGCTGCTTTCAGACCAGCTGTTAGGCTTCCCCCTGCATAAGTCAAGGGCAGGAGATAGACGAGAATCTGAGAAACCTGACATCGACTTGGA

AGATCCAACTCAGAAAAGTTATTATGAGGCATTACTATTAGATAAGTGCAACACGGAAGAAGCTTTGCTGGCAAATTCCAATCAGGATTGGGGTTACTTT

GAGACTTTTATTAGTGAGAGTAAGATTGAGCTACTTGACCTCTGTTCCAAGAATGAACTGTCTGTTAACCTTTTCTCTGAAGAAGATGTGGAGAACTATA

TGTTCGATGATGATGAGTCAACCCTGGGCAGTGATGTCTGCTCCCTCAAAATTCGATATGAGTCCTTTCAGGACAATGTTCGAGACAAGACCACTCTTCT

GATGCAGGAAGATGCCCAATTCAATTTTTTCCCCAGTGTCTTTACTACGTGTCCCAAGCGGGAATCTAAGAGTGGAATCCTCAAGCAGAGCAGTGATCTT

TCTCAATTCAAGGTCCCTGATGTGAGCATCATCTGGGGAGAAGAAGATAAAAACTTGGACAAGAAGAAAGGCAAAGAGGAAGTACATGAAGACAAAAGCA

TAGAGACAAAAGATGAAAAAGATAATGGAGAAAAGCCTGCATTAAACAATAAACCATGTGGTGGTCTTGAGGTAGAGCAATTTAAGAACCTAAAGGCTGA

CCAACTTACTAATTCCCTGGAGACATCAGGGAATTTCAGTGATGACAGTTCCTTCATTGAGGTCTCATATGATGCCATGGGGGAGATCAAAGACTGTAGC

CGCTATATGGCTCGGGACACTAATTCTGGAAGTTCATCCTCCCAGCAGAACTACGGACTGCGAGCCAAGAGAAAAGTCAGATACAGCGAAGATTATCTAT

ATGATGTTGACTCGCTAGAGGGGGAAAAAGTAAATGAGAGAAAGGAATGGCCTCCAGGTGGTTCCAAAGAAGAAGATGATGATGAATGGTGTCCCAAAAA

GAGAAGAAAAGTAACACGTAAAGAGCCCCCTGTTATTATTAAATATATCATTATCAATCGTTTTAAAGGTGAGAAGAACATGTTGGTGAAGCTAAGTAAA

GTAGATGCCAGTGAAACAACAGTAAATCTGAGTGAGAATCAGCTCAGTAAGTATGCCAAGCTATCACCTTTGAAAGGATTCTGGCAAAAGAAGAAAAAGC

AGAAAAACAGCAACACAGACTCAGTCAAAACACCCTTATGCCAAAAGCAAAGCTTTGAACCAGGTAGCTTTGAGGTGTCATTCCTGCCTCCTGCTCGTAA

ACGAAAATCTAAGCTTGGCAACAGACACAGGATTCAAAGGATCCAATCTGTGGAAACTTCAGCAAGTAGTAAGCAGGTTTCATTCTGCAGTGATCAGAAA

CAAGCTTGTAATCGCAAAGAAGACGGTGTAAAAGGGACACCAAAATCAGCACTTCTTACTGACCCAAGCTGTGCCAATGGATCACATTTACGTGGCCTCA

TAGTCTCCGACTCGGTTAAAGTCAAAGCTCAAGATACAGAGTTCAAGGGCCCAGAGAGGAAAGTGCTTAACAAAATTAAATTTAAAAGTGAAGCTAGGTT

AAAATCCAAAAAAATCAAAGCTGGACAAGAAAACAAACCAGTTGTTCAAATGAGCCCTGTCTCAGAAGACACATCCTCCAAGGCTAATTTAAAAAATGAA

GTCACTCCTGGAACCTCAAACAGTTCCCATATGTCTGAATTTCACGAGACAAAAGTTAAGAATTCCACTTTCCTACCAACCACCTGCTCTTCTGAAATGC

CTCTATCATCTGCTAATGTTGCCACTAATATACCTGTTATTCCTGGAGGGTATCTGCAAACACTGTTAGATGCTTCTGACTTATCAAATAATACTAGTAT

CTCATACTTCACCAACCATTCTGCAGAGCAAAATGAAGGCAGCCTCACTCAAACGGAAAAAGCATTTGTACCTCTCCAGTCTGCTCAAGACTGTGTGCTG

TCTTCATCTTCTGATTCTCAGCTGCAACAATCATCTCAGAACTTCAAAATGGAAGCAAGCAACTTTGGAAGTTTGTGGCCCGACAAGGATACATCTGGCT

CCCAGGAATTCATGACTGAAGTCTCAAGGGAGATAGCCACAAACCAATCTAGTGAATTTGAAGCTTCCCAAGTTGTCTCCATGGAGAATAACCTCACAGC

TATAACATACAGTCCTGTATGCCTCAATAGTGATGCCAGTGGTTGCAACAAGGTTCTGTATGCCTCTTTGCAGGACTCACATCTCCCACCTGAAGACTTG

TATCAATTGTGTCACTTTAATAATGGAGAGATCTGCTTTCCGTTCCAGCAGGGCCCACTCAGTACAGATGATGATGGCCGGCTCTTTAGCTTTGATTCGA

TGACTTCCCTTACTGTTAGTTCAAGCAATTATTGTTCCTTAAGCTTGAAATCCTGTGAAAAGGATGGTGATGATGAAATCAATGATGACTTTCTGGCCCA

CTGCAGCCCCAAACTGGTGATCCAACAGAGCATTGATGAAATAGCACCACTAAAGGAGTCCACTGACCTCCTTGACATCTCCAACTTCACTCCTGACAAG

TTCCGACACTCTTCTCTCTTAGAAATGTCTCCCCCAGACACCCCCAGTCTTTCTCCTCAGAGTACCAGATGTGAGAGTATCAAAACACTAGGAACAATGA

AAGGATTCCAAGAAGGTGTCCCAGGATCGTTGAGCACCGTGGAAAAAATCAAGTGGGACTGTAATACCCTTTCACAACAGGCCCAAGCAGATGATGGCTT

TACATTAAATAGCCATCAGTTTCAGTTCCATATGTTCAATGATGAGGACTCTGTTGGCCTGCTCCAAAAAAGCCCTTGCCTGTCAACATTTGATGAGCCA

GCTGGGCAAATTAATACCAACAGCAAAGTGTCAAAATCAAGAAAGAAAACTTCACCTGGCAAGAGTGGGGCTGTAAGCCAAAGTTCTTCTCAGAAAAATT

CCAGGAAAAAATCGCCAAAAGCAAGCAACAAAGGGGTTGAAAAGCCACCTAGCAAAACCTCCCGCCAGGTTCCTAAATCAACAAAGAAAGGGAAATATGT

GGCTGCTGTCAATGGAGAGAAAATGCAAATTGGGATTGGCCATAGTGGGGGCCAACCCAATAGTACATCCTCCAATGCAAAGACACTGACTGAATGTATT

CAGCATGGTGGTCCTGTTGCCTCTATGAAGATACCAAGTCAGAAGGGACTTTCTGGAGATTGGGCTTTGGGAAAGGAAAGCAGGCCAGGCTGGAATGACA

TGAGTGTAGTCACTAATACCAACAACCTTCTGGATGATGACCAACGAGAGTTTCAAGAGCCTTCCTATATCTTATCCAATATTGCCTCTGGTATGGCAGA

TGTGCAAAGATTCATGATGGCCTCCATGGAGCCCCTTTGGGAACCCATGGAGCACCAAGGGGAGTCCAACACATTCTACTCCCCTGATTCCAATAGCCTA

AAATTAAAAACCCTCAAAATACTGGCTGGAACACCACAAGAATCTAAGAAAAAGGTTACTAATGGGTCTTCAGGAGCTACTAAGAATCACAGGTCAGTCA

AAGCTGTGAGCAAAAGCAACGGGAAAGCGGCAATTGGTGAGCCTGGTCATGCAGATATGCCTGGTTCCAGTGAGGACTCTCGATCTGCCTTCTTTGATAA

AAAGTACAGTAATGTGAACACTTTAGGCAATAATGGACCAACACACAAAAAATTATATCGTCACAAATCCAGCTCCAAGGGCCTGCGAGATGAGAAATAT

AAGGGAAAGCGCGTGGAACGAGAACAGGCCCACAAGGATGAGGCTGGAACAACTTCTTTTGAAAAACTGAGGTAATACTGCACCAAAATGGCTCAGATGA

GATGCGCCCTTGGCTTTCCTACTACCTGCTGAGCCCAGAGTTCCTATTTTTCCCTCTTGAAAGCGAAGTTTTGCATGAGAGACTCTTTCCCATTCTCCTC

TTTTTTTCAAATTAAAAAGAAAAGAAAAAAATGCATGGAAATCCCTGTACCTTTAAGCCACCCAAAATATTGGGCAATTTTATTGTGGCTTAGCTAGGGA

TAAGTTCTAACAAAGGCTACATTTTTCTTCTATTCAGCGTTAATTTTTGCTTATTAAGGAAATAGAACTAAAACATGCTCTTGAATGATTTTTGGAATGG

AAGGGCTTTGCAATAAAGACAGATTCTGGACAACATATTCAAAAAGTCATGTAGACAAAAAGCCAAGATCATTTAAACAAAAGAGCATTAGTTGTCAGCA

CATGACAATTAGGAGTGCTTTCTCTACCTTTCTGCATCATACAACATCTAGTATGGTGTTAATATATTTACAGGGTATGATCCCTTCGTGGGACATACAC

TAAAACTTACTAAGATGGCATAAATTCTTTGATTTTTCTGCAGGGATTCCAACTACAATCTCCTAAAAGCAGAAACAGCATTTGGGGTTTTACCTGTGTT

TGAAGAAGAGACTCACATTTTCCAGAAAGACATTTGATGTTTGTGTTTTCTTTCTTTCAAAATAAGCTTTGTGGTATGTATGTTGACCTGTAAGTGCTTA

CAAGAAAAGAATTTTAAATCGTGGGAATAAGTCTTTGAAATCAAACTTTAATCTGATGTTCTGTGTAAAAGACTTTAAAAGTCATACAGTTGCACGAGTA

GTTTATGCACTGTTTGCCCACAAGGAAAAAAATGGAAAACTTTGTGCCAAACTACAAATAAGTAACTGTATTGTATATAGTTTTACTTCTATATCAACAT

TTGGTTGTGAGTATTTGGGGGACTTGTCCCTGTTAATTTACTAGAAACATTCCAGTGATTCTTGCTATTAACCACCCCCACTTTTGTGGATAGCACCTAT

AGATCACAGTGGAAAATATGTTGTGTTATACAGTTTACCAAAACAAAGGATAATGTTTGAATTGTGCCAAATTTTCTTACTTCATCTCACAGATTCACCC

CACAGTTTAAAACTCATTCATGATTATTAAATATATATATACATATACATCCATACATTCTTTTAATGTTTTAAACTCTACTATCCTGTGTGGAAATATG

AACAGTTAAACAAGGCACAATAAAGATGTGTTTGTTCCATCATCTAAGGATTAAAATGTTGGAAAAGCTTAGGTCACAACAGCTAAGTCCATCAGGGACA

GAGTATACACATTTACAGAACCTTGCACAAGGAAATCAAACAGCTGCTTTGAAAGTTGGTTTTCCAAAGCAAAATCTGTAGCAGAAAAGAATTTAAAGTG

CAAAGTTATATTGCTGATACTTTATATCTCAGTTTTATATATTTTATAATAGCCTGGGATAAATTATAAAATAACTATAAAATTGACACTAATAATAAAT

AAAATACATAGATTGCTTTTATTTAAGTAGTTTCCTAAATGTTTTATTCCAGTTATGTCAAAAGTGCACTCACAACATGGCTTTAGTGTTCTTTAAATGT

TGATCTTGCAATGCCAATGTCATTTTTTAAAATGACATCTCAGATTGACAGAATTTTTCTTCCTATGATTAAATACATATACCACCAGGTAAAGCTGAAC

AATATGTGGAAATAACTAATTTAGGCCATCTACATATAGTCTGAGGATGACTACTCTTTTGATATCACACACTAAACATAAATCTCAATTTTTAATTACC

TTTTAAATTCATATTTTTGGTTCAACCCTCCCTTTCACTACTTAGAAACTTCACAGTTCCCACATTCCTCACTACTAGCCTTTTCTTCCCCTTTCTTCAC

CACTTGACTTATACCATTTGATCTCTTTTCCTTGCACAGTTAAGGCCTATGTGCCTAATGACTGATGCATTGTGGCACAGATGAGATAATGGATGTGAAA

GCGCTTTGTAGATCATAAAGTGCTATACCAATATAGGGGACTAATATTATTAATGTTGTTGGTTGTTGTTGTTGTTACTATTCTTACTAATATTGTTACT

AACCTATTAACTTGTGAATATAGAGGCTGGGGTGGGAGGGAGGAGGATAAGGGGGTGGGAGAAGGGGACTTAATAAAACAGGGAAGATGTTTCAAAAGAC

ATTTTTGAATAAAATATGAGCAACCTACCTAGTCATTGACACCTAAATATATTCACAAACAGAGAAGCAATGTTTTCAAGTAGTCAGAGAGAAATGGAAG

GGAGCCTATCATGTATATAAACATACACATTTCCCAGCCCATGATTCCTTTCACCAGCTTACTCTACTACTTACAGCTAGGTAGGAAAATGAACAAGCCC

ATGATCTAGATTGTGTGTGTTCTCAGCATCAGTCTCTTTTGTCTGTGGGGATGAGTGGGTGAGGAGAAATCTGTGAGGAGAGTTCAGGCACATTCCTAGG

CTTTGACACTGTGTTCAATGAGCCCTGGAAAATGATTTAGTGGGAAGGCACCAACTGAAACAAGTCTCTTGCCCTACAATGACCATCCAAAAGAGAAAAT

AATCAAACTAGAACACTTTCTTTTGTTTCTTGGTACTCTAATAGCTAGCTGTTTGTATTAAATGTGATGGCTACTTCCTAGGAACTGGTCTTTGTTCAGT

TTTGGTTTTTGTCTTGTTTTGCAGCTGACCTTTTGCTTAGAATCATCACCTCAGCCTGTATTGTGATCCCCAAGACTCCAGACCTCAAACTCATCTTGCT

TGGTTTTAGGAATGGAGTGCTTTCTATGTAACCAAAAAGTGGAAATTAAAGAAGAAATAAAGAAAATGTTCTATGAGTATAATGTGTTTTTATAAAAGTA

AATATGGGAGCAGTTGTCCCAGATTTTTTTAAAGTATCATGATGTTCAGCTTTGGAGAATGGGGTAAGACTGGGGTAGGATAGCTTGAAACTGTTTCTAA

CAGTTTCATTGTCAGAACTTGATCATCAGTCCTTTGGAGTGGATACTCTTTCAGTTGCTCCTATGGAGCCCACTAGGGGCCAATTTTAGGGCATGGTTCA

TATCTTTCTCCAAAGAGAACTGCCATTTTAAAGCACCTTTTTATCGGCCTGCCATGCATTGTATGTTCTTAACATATAAACTAGTGACTTGTAACCAGTC

ATTTTGTATTGAAACATAACAAGAAAGTGAATTTGAGGAGTGTGCAATAGACCAAGGCAGAGATGTTATTGTACACTATGCTCTACATTGTTGAGCACTT

TGCATTCTGTTGGTCCTGCCTCTGCTCTCAGAATTATTTTCCTTTCTGTCACAACATAGTAGGCCAAACTTACTGGAGATCTCTTATTCAACCAGCTGCC

TTAGTGGAGTGAGGACCAATGTATGAAAATAGTGTTTTGCCCTATCACTGATTTCTTCAACTCAAAAACCCTGGATTTTCCTTGATCTGAAATTTCTGAC

TACCCCCTTCTAACCTCTCCTTTCTGAGAAGCTGCATCCTATTAATGCCTCCTCATTGGAGTCTCATTTAATCTTTACTTTCCTGGAAATTATATCCTCC

CTTGTTCTTCTTTCTTGACTTTTATCAGTCTTAGAATTTTTCTTCTTGTGTAGTATTCTATTCAATATCCCAAACTGTCAAAGTTTAAGAACTACAGCTA

GAGGCTTTCTTTTGGAAGTTTAGAGGACTACCTTCCCTGTCTTATTCACTCAAAATACAAATGCACGAGCACATGCACACATAGCATTGAGAAAAGACTG

AAACTGCTTTCTCTTGAAGGTGTGTGATAACAGGTCCAATCTCTTATTGTGGTCAGGTGCTGTACTACATGGAGCAGAGTGCAGATACAATGGCCCCAGC

CAAGGGTCTTCAAGACATTGAGGGTTGTGTTGGGACTAGAGTAAATAGCTTGAACCTGTGGCCATCCTCTATGCCTCTCCAGTGTCTCAGATCTCAGCTG

CTTCACATATGCTGCTCCCTCACAGCTTTCCCTACTGACTTCTTGCTGCTCTGTGCAATTATATGTTAAGGCCTTATCTTTTCCTATATCTTTTCAAACT

TTCTGCACTACTTCATTCATCACTTCTTTAGCCATCTCTCTGAAGTCCTTGGTGCTAGGTGGGCTTTTGTGACAAAAATTTTCACCTTCTCTGACTCTTT

TCTTTGCTGGGAAGAATCGTTGGGGGGTAGGGAACACAAAGGAGGGTATGTGTGTGTGTAAGAGAGAAGCATAAAGGATGCTTCAAATGCTGTAATCAAC

TCCCATCCTGTGTTATTTCACGTGAGGTCTTGCAGTTCTAGTGAATTTCCATTTTAGTGGCTTTGAAATAGTGTTTACTGCGTAAAGGAGAAAAGCATAT

CCAAGGACCTCTTTGCCTTGCTCTTACCAAACTGAACTAGTGTTTTGGAGATCTACAATTTATAGATGCACTCAGAACAGTTCTGAGAAATGAGGAGAGT

TAGAGTTGAGTTTCTATGCTGAAGAGGTAAATGGAACACTAGCTAGTCCTAGCTGTTGCTAGAACTAGAAATGTTTGTTTTCTCCTGTTTGACTGAAAGG

TTGTCAAATTATTCATTTTCATTTAGGGCTTTTAATGCTGCCAGTCATAACAGAAATATCTCCTTTTGTAAAATAAAACTAATGCAAGTTTTGTTTTTTA

ATCATAAAATTCTCTAAGCCAATATTATGTTTAGAAGGCTTAGTACCAAAATCAAACATTTTCATGACAAACAGAGATCTTGTCAACATAATGTAGGCCA

GGGATTTTATAGAGATTTCTCAAAGACCCGAGTTAAGGACAGAAATTAGTTGAGATGTTTAGTTTGGGAAACACTACTACCATCAGCTTAAGAGTCCTCA

GCCAGCATGGAGTTATTTTGGTGACTATGCAGGCTACCCTTTAAGACACAGTTTTCACTCAACATTAAACAGTAGCTACAGTCATGATGCAGAGATCCCA

TTGCAGCTATATGATACTTGAGGTGTACTCTTGGTTTGAGAATCATAGCTAAATGCTAAAACACTGGGGAAAGACACTATAAGAGAGTGGCTTAGTGGAA

AGTTTTAAGGAATGAATGAGGCTTTTAAAAATCAGTGTTTGGGTAAATCAATACTAAATACACTAAAGAAACACTCACCCATACAATATGAAAAGGATGT

CTGTGTATCCAACAAGCTCAGGGTTCTCTGGGCCCACTGAAAATGAAGAAAGGTAACCAGGCATGGAGGCTCATGCCTGGAACCCTAGGCAGGATTGTTG

GGAGTTCCAGACCAGTCTGGTCTATAGTGTGAGACCCAGTCTGAAAAATAAAAATATAAAAGAAAGAAGGAGGATGAGGAAGGAAGGAAGAAATGAATGA

ATGAACAAATGAAAGAATCAAGGAAGGAAGGGAGGGAGGGAGGGAGGGAGGGAGGAAGGAGATACTGAAATCATTCTGCCTCTTTGAGAGATGCCTAGTT

TTACAGCACAAAAGAAAAAGGCTTGAATGAAAACTAAAAGGGGCCTTTTTGTTTTTCACTCCCAGGGAGGTGGAGAGCTTCAGAGTCTCCACTGGGATAG

CTGTAGCACTGACTGGAGTTTGCTGCCTACAGAGTTTTGAATGTACTTACTAGACTTTAGTTTCCATAGAACTGAATGCACCTCTTCAGTAAGTGAAATG

CTTTATGGTGCTAAAGAAAATGATTATCCCCATTTTTCTTCTTCGCCAAGCCCCTTAAGCATTTAAGAAAATTTAAAGTAAAAGCATTTAGAGACCCTTT

TTATGAATGTAACCTGTTTCTGTTTGACACATGACACTGCAACTTTAAAGTTAGGAAATTATTTGCCTTTTTCTTTTAGAATTAAGCTTTATAAATAATC

TGTAGAGTCAATTGAAGTATAAAGCTTAAGGATCACTCTTAAGACGCCTACAAAATCTTGTATATTTTTAAGTGTGCCAATTTGTAACATATTTTGTAAG

TGTATATTTTTCTTAGAAAAGTGCTGTGAAGTGTCTGTATGTGAGAGTTTTCCTTTTTTCTGCACCACTATGTGCTAATAAAAGGATATTTACTTCAAAG

TTTCTGGTTTTAGAAACCACAATACAAAGAAAAAACACTTTTGTTGGGAATTTTGTAACAAAAAATATGTTGTGAAAGAGTGTAGTGATCTTGTGCAAAG

AAAATGAACATTTGTGAGCTTCTTGCTGTTTTATAGAATTTCTTGTAAATTATTCTTGTAACACCTCTGGTTTTGTTGTTCTTGTTGAAAAAAGTTTTAA

ATATTTGTGACTGAATGTATGGTGAAACTGTCATAATGTTACCTAGCTGAGTTTTGTTATTGTTTATGGAATAAATAAAAGAAAAGTTTAAA
Translation
 - UNI30077 -  - UNI30077 - MDNQQDKVIAASANGDNNLINGVKNND DSEDQEVAMKSFVALEATTPIQPIPVIQKESPMFPRGLLPPPSK

KPCMQSPPSPLALIEAPDHSANSASVNAISLTSGVAKGLNTWSLPNECEKAPFAIMEPAGMSALNGDCLMQPSRTCLGCFMESKEAVDPEPGISLKVSDL

NRDYETCAVSDIGIQCINAGENIKYGEQLLSDQLLGFPLHKSRAGDRRESEKPDIDLEDPTQKSYYEALLLDKCNTEEALLANSNQDWGYFETFISESKI

ELLDLCSKNELSVNLFSEEDVENYMFDDDESTLGSDVCSLKIRYESFQDNVRDKTTLLMQEDAQFNFFPSVFTTCPKRESKSGILKQSSDLSQFKVPDVS

IIWGEEDKNLDKKKGKEEVHEDKSIETKDEKDNGEKPALNNKPCGGLEVEQFKNLKADQLTNSLETSGNFSDDSSFIEVSYDAMGEIKDCSRYMARDTNS

GSSSSQQNYGLRAKRKVRYSEDYLYDVDSLEGEKVNERKEWPPGGSKEEDDDEWCPKKRRKVTRKEPPVIIKYIIINRFKGEKNMLVKLSKVDASETTVN

LSENQLSKYAKLSPLKGFWQKKKKQKNSNTDSVKTPLCQKQSFEPGSFEVSFLPPARKRKSKLGNRHRIQRIQSVETSASSKQVSFCSDQKQACNRKEDG

VKGTPKSALLTDPSCANGSHLRGLIVSDSVKVKAQDTEFKGPERKVLNKIKFKSEARLKSKKIKAGQENKPVVQMSPVSEDTSSKANLKNEVTPGTSNSS

HMSEFHETKVKNSTFLPTTCSSEMPLSSANVATNIPVIPGGYLQTLLDASDLSNNTSISYFTNHSAEQNEGSLTQTEKAFVPLQSAQDCVLSSSSDSQLQ

QSSQNFKMEASNFGSLWPDKDTSGSQEFMTEVSREIATNQSSEFEASQVVSMENNLTAITYSPVCLNSDASGCNKVLYASLQDSHLPPEDLYQLCHFNNG

EICFPFQQGPLSTDDDGRLFSFDSMTSLTVSSSNYCSLSLKSCEKDGDDEINDDFLAHCSPKLVIQQSIDEIAPLKESTDLLDISNFTPDKFRHSSLLEM

SPPDTPSLSPQSTRCESIKTLGTMKGFQEGVPGSLSTVEKIKWDCNTLSQQAQADDGFTLNSHQFQFHMFNDEDSVGLLQKSPCLSTFDEPAGQINTNSK

VSKSRKKTSPGKSGAVSQSSSQKNSRKKSPKASNKGVEKPPSKTSRQVPKSTKKGKYVAAVNGEKMQIGIGHSGGQPNSTSSNAKTLTECIQHGGPVASM

KIPSQKGLSGDWALGKESRPGWNDMSVVTNTNNLLDDDQREFQEPSYILSNIASGMADVQRFMMASMEPLWEPMEHQGESNTFYSPDSNSLKLKTLKILA

GTPQESKKKVTNGSSGATKNHRSVKAVSKSNGKAAIGEPGHADMPGSSEDSRSAFFDKKYSNVNTLGNNGPTHKKLYRHKSSSKGLRDEKYKGKRVEREQ

AHKDEAGTTSFEKLR

For any suggestions or comments, please send an email to unitrap@crg.es