Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000046532 (Ar)
Chromosomal location
Chr X: 95345060 - 95513456 (+)
Description
cytochrome P450, family 19, subfamily a, polypeptide 1 Gene [Source:MGI (curated);Acc:Ar-001]
Human Ortholog
not available
Omim not available
UniTrap UNI35379
Vector Insertion
Chr X: 95346674 - 95447024
Public Clones IST14783B10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000052837
Sequence
AGAGCAAGAGACGAGGAGGCAGGATAAGGGAATTCGGTGGAAGCTACAGACAAGCTCAAGGATGGAGGTGCAGTTAGGGCTGGGAAGGGTCTACCCACGG

CCCCCATCCAAGACCTATCGAGGAGCGTTCCAGAATCTGTTCCAGAGCGTGCGCGAAGCGATCCAGAACCCGGGCCCCAGGCACCCTGAGGCCGCTAACA

TAGCACCTCCCGGCGCCTGTTTACAGCAGAGGCAGGAGACTAGCCCCCGGCGGCGGCGGCGGCAGCAGCACACTGAGGATGGTTCTCCTCAAGCCCACAT

CAGAGGCCCCACAGGCTACCTGGCCCTGGAGGAGGAACAGCAGCCTTCACAGCAGCAGGCAGCCTCCGAGGGCCACCCTGAGAGCAGCTGCCTCCCCGAG

CCTGGGGCGGCCACCGCTCCTGGCAAGGGGCTGCCGCAGCAGCCACCAGCTCCTCCAGATCAGGATGACTCAGCTGCCCCATCCACGTTGTCCCTGCTGG

GCCCCACTTTCCCAGGCTTAAGCAGCTGCTCCGCCGACATTAAAGACATTTTGAACGAGGCCGGCACCATGCAACTTCTTCAGCAGCAGCAACAACAGCA

GCAGCACCAACAGCAGCACCAACAGCACCAACAGCAGCAGGAGGTAATCTCCGAAGGCAGCAGCGCAAGAGCCAGGGAGGCCACGGGGGCTCCCTCTTCC

TCCAAGGATAGTTACCTAGGGGGCAATTCAACCATATCTGACAGTGCCAAGGAGTTGTGTAAAGCAGTGTCTGTGTCCATGGGATTGGGTGTGGAAGCAT

TGGAACATCTGAGTCCAGGGGAACAGCTTCGGGGAGACTGCATGTACGCGTCGCTCCTGGGAGGTCCACCCGCGGTGCGTCCCACTCCTTGTGCGCCGCT

GCCCGAATGCAAAGGTCTTCCCCTGGACGAAGGCCCAGGCAAAAGCACTGAAGAGACTGCTGAGTATTCCTCTTTCAAGGGAGGTTACGCCAAAGGATTG

GAAGGTGAGAGCTTGGGGTGCTCTGGCAGCAGTGAAGCAGGTAGCTCTGGGACACTTGAGATCCCGTCCTCTCTGTCTCTGTATAAATCTGGAGCACTAG

ACGAGGCAGCAGCATACCAGAATCGCGACTACTACAACTTTCCGCTGGCTCTGTCCGGGCCGCCGCACCCCCCGCCCCCTACCCATCCACACGCCCGTAT

CAAGCTGGAGAACCCATTGGACTACGGCAGCGCCTGGGCTGCGGCGGCAGCGCAATGCCGCTATGGGGACTTGGGTAGTCTACATGGAGGGAGTGTAGCC

GGGCCCAGCACTGGATCGCCCCCAGCCACCACCTCTTCTTCCTGGCATACTCTCTTCACAGCTGAAGAAGGCCAATTATATGGGCCAGGAGGCGGGGGCG

GCAGCAGCAGCCCAAGCGATGCCGGGCCTGTAGCCCCCTATGGCTACACTCGGCCCCCTCAGGGGCTGACAAGCCAGGAGAGTGACTACTCTGCCTCCGA

AGTGTGGTATCCTGGTGGAGTTGTGAACAGAGTACCCTATCCCAGTCCCAATTGTGTCAAAAGTGAAATGGGACCTTGGATGGAGAACTACTCCGGACCT

TATGGGGACATGCG - UNI35379 - TTTGGACAGTACCAGGGACCATGTTTTACCCATCGACTATTACTTTCCACCCCAGAAGACCTGCCTGATCTG

TGGAGATGAAGCTTCTGGCTGTCACTACGGAGCTCTCACTTGTGGCAGCTGCAAGGTCTTCTTCAAAAGAGCCGCTGAAG GGAAACAGAAGTATCTATG

TGCCAGCAGAAACGATTGTACCATTGATAAATTTCGGAGGAAAAATTGCCCATCTTGTCGTCTCCGGAAATGTTATGAAGCAGGGATGACTCTGGGAG C

TCGTAAGCTGAAGAAACTTGGAAATCTAAAACTACAGGAGGAAGGAGAAAACTCCAATGCTGGCAGCCCCACTGAGGACCCATCCCAGAAGATGACTGTA

TCACACATTGAAGGCTATGAATGTCAGCCTATCTTTCTTAACGTCCTGGAAGCCATTGAGCCAGGAGTGGTGTGTGCCGGACATGACAACAACCAACCAG

ATTCCTTTGCTGCCTTGTTATCTAGCCTCAATGAGCTTGGAGAGAGGCAGCTTGTGCATGTGGTCAAGTGGGCCAAGGCCTTGCCTG GCTTCCGCAACT

TGCATGTGGATGACCAGATGGCGGTCATTCAGTATTCCTGGATGGGACTGATGGTATTTGCCATGGGTTGGCGGTCCTTCACTAATGTCAACTCCAGGAT

GCTCTACTTTGCACCTGACTTGGTTTTCAATGA GTACCGCATGCACAAGTCTCGGATGTACAGCCAGTGTGTGAGGATGAGGCACCTGTCTCAAGAGTT

TGGATGGCTCCAAATAACCCCCCAGGAATTCCTGTGCATGAAAGCACTGCTGCTCTTCAGCATTA TTCCAGTGGATGGGCTGAAAAATCAAAAATTCTT

TGATGAACTTCGAATGAACTACATCAAGGAACTCGATCGCATCATTGCATGCAAAAGAAAGAATCCCACATCCTGCTCAAGGCGCTTCTACCAGCTCACC

AAGCTCCTGGATTCTGTGCAGCCT ATTGCAAGAGAGCTGCATCAGTTCACTTTTGACCTGCTAATCAAGTCCCATATGGTGAGCGTGGACTTTCCTGAA

ATGATGGCAGAGATCATCTCTGTGCAAGTGCCCAAGATCCTTTCTGGGAAAGTCAAGCCCATCTATTTCCACACACAGTGAAGATTTGGAAACCCTAATA

CCCAAAACCCACCTTGTTCCCTTTCCAGATGTCTTCTGCCTGTTATATAACTCTGCACTACTTCTCTGCAGTGCCTTGGGGGAAATTCCTCTACTGATGT

ACAGTCTGTCGTGAACAGGTTCCTCAGTTCTATTTCCTGGGCTTCTCCTTCTTTTTTTTTCTTCTTCCCTCCCTCTTTCACCCTCCCATGGCACATTTTG

AATCTGCTGCGTATTGTGGCTCCTGCCTTTGTTTTGATTTCTGTTGTATTTCTTTGAATCTGTGATGATCCTCTTGTGGCCCAGTGTCAATTGTGCTTGT

TTATAGCACTGTGCTGTGTGCCAACCAAGCAAATGTTTACTCACCTTATGCCATGGCAAATTTAGAGAGCTATAAGTATCTGGAGAAGAAACAAACAGAG

AGAATAAAAAGCAAAAACAAAACCAAAAAATAAAAAAAACACAAACAAAAAACAAAACCAACAAACAAAACATGCTAGGTTTGTTTCTTCGTGGTATACA

AATAAACACATAGGATTCCCAAAGAAGCCGACAGTGACTAGAAGAAAGTAAAAAATTACAAATCCACGAGGAGTCACTGTTTTTGTTCATCCTGTTTCTC

TGTGGGAAACTTCAGTTGTTGTTAATGGCTATTGCCATTAAAGAGCAGGTTGACCCCAAAGCTTTACTGATAGGGTAGAGAGAAAAGAGGACAAGGAGGG

CAGATGGATAACCATTACCTCCCCACAGCCTTTGTCCCTGAGTCCTAGAGTGCTCAGTTGCAGTGTAGTTCCTTGTACTGAAATGTGCTTCTTGTTTGAA

AACTTGTCTGCATGTGAATGCCTCTTCCTTCCAATCCTTTTCTCTCTTAACCTCTGCTTCCACCCTCAATTGACTTTCAATAGCTTTTCTCAGAGCTTTG

TACTATATGCTCTCTTTAGCCAAAACTTGGCCACTTTCACTGAAGTTATGTCAGTGAGAAGAAAGTGGAAAGGTCTGACTCTTTGGAAGGCTCTATTCAG

ATTTATGTTCATATTTCCATGTGTGAGCCATAGCGGAGCTTTGTGACTGGAGTCAGAGGAAAAGGAAGTGATGGCTTAGCCATTCTCCCATTAGAGATAG

TGAATGATGATGCCATAGTGCAATCATCCTTTCCTCTGCTTTTAAAGGACCTAGAGACCCCATGCAGCCACATTCTCCCTGCACAAGTCTTCAGTGTTCA

GTGGCCCTGAACTTCACC
Translation
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREAIQNPGPRHPEAANIAPPGACLQQRQETSPRRRRRQQHTEDGSPQAHIRGPTGYLALEEEQQPSQQQA

ASEGHPESSCLPEPGAATAPGKGLPQQPPAPPDQDDSAAPSTLSLLGPTFPGLSSCSADIKDILNEAGTMQLLQQQQQQQQHQQQHQQHQQQQEVISEGS

SARAREATGAPSSSKDSYLGGNSTISDSAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYASLLGGPPAVRPTPCAPLPECKGLPLDEGPGKSTEETA

EYSSFKGGYAKGLEGESLGCSGSSEAGSSGTLEIPSSLSLYKSGALDEAAAYQNRDYYNFPLALSGPPHPPPPTHPHARIKLENPLDYGSAWAAAAAQCR

YGDLGSLHGGSVAGPSTGSPPATTSSSWHTLFTAEEGQLYGPGGGGGSSSPSDAGPVAPYGYTRPPQGLTSQESDYSASEVWYPGGVVNRVPYPSPNCVK

SEMGPWMENYSGPYGDMR - UNI35379 - RLDSTRDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEG GKQKYLCASRNDCTI

DKFRRKNCPSCRLRKCYEAGMTLGA ARKLKKLGNLKLQEEGENSNAGSPTEDPSQKMTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALL

SSLNELGERQLVHVVKWAKALPG GFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNE EYRMHKSRMYSQCVRMRHLSQEFGWL

QITPQEFLCMKALLLFSII IPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQP IARELHQFTFDLLIKSHMVSVDFPEM

MAEIISVQVPKILSGKVKPIYFHTQ

For any suggestions or comments, please send an email to unitrap@crg.es