Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000046603 (D9Ertd402e)
Chromosomal location
Chr 9: 122714716 - 122745447 (+)
Description
Uncharacterized protein C3orf23 homolog  [Source:UniProtKB/Swiss-Prot;Acc:Q66JZ4]
RefSeq_dna
NM_001013405 
RefSeq_peptide
NP_001013423.1 
UniGene
Mm.215892 Mm.417240 
MGI
MGI:1196217 
Uniprot/SWISSPROT
Q66JZ4 
Human Ortholog
ENSG00000179152 (C3orf23)
Omim not available
UniTrap UNI22422
Vector Insertion
Chr 9: 122717955 - 122720875
Public Clones not available
Private Clones OST297475 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000052740
Sequence
CTGCCAATCATCTTTCTCCCTCAGACCTAGTCGGCCGGAAGAACCGGCTTGTGTCTCCCGAAGCTGCCTTCGGAAACCCGCAGATAGCGGG GCAATTAA

TGGATGCTTGGAAGTTGGCGTGCTTATTCGGAAATGTTTTGCCACTTGAGGCCTTTGAGGAG - UNI22422 - GTTCGGCCTGAGGAAGGTCCTCCC

TCATTGGCTTCACTACTCTCGAGCTTTATCAGGGGCAGAAGCCATCAACGCCTTGAGGCCTTTCTACTTTGCAGTGCATCCTGATTTCTTTGGACAGCAC

CCCAGGGAAAGG GAAGTCAATGAAAATTCTCTTAAGAGATTAAGTGTCTATTTAGAAAATCTCCAGAAACCAGGCTTCAAATCTCTGAAACCAACTCAG

CTTACATTTTATATAAGAGAAAAAACAGCCCAGAATTCCTCTGAAGGCCAGGAGCCTATCAGTACTACCG GATTCCGAGCAGTCAGATTTACTTTGCAC

AGCAGCGATCTGCTAAGCACAGTATTGTATATTCTCAACTCCTGCAGTTTGCCTGTTGAACACGTCCAAAGCTTGAACACTAATGTGCATTCCCAGCCTC

TCAAGGAAGCTACAGGGATGCCTGACAGACCCATCAAATGGCATAGGTCCTATTATTCCTTTACTGGGTTCAAGGACCCTGATGAAGACCTCACACACGT

CTCAAGAGTGGAAACAACCCTAAC GTCCTGGTTAGGTAGCAATGGGAAAGGTGCCGTGAAGAAGCTGAGGAACAGTCTGCCACTTCGGAAGGAGCTGGA

TCGCCTGAAGAATGAGCTGTCTGAGCTTCTGCAGCTTTCAGACATCAG GTGGCAGAGAGGCTGGGGAGTTGCCCATCGCTGCAGCCAGCTGCACAGTCT

CAGCCGCCTAGCACAGCAGAATCCGGGGCCACTTCAGAATGTGAAAG GATGCACGGTTGTATTCACAGACCGCTCCGGTATGAGTGCACTGGGCCATGT

GATGCTGGGAACCATGGATGTCCACCACCACTGGACAAGG CTTTTTGAAAGCTTGCCAAGTTATTTTGACCTTCAGAGGAGAATGTCAGCCTTAGAAGC

CCAAATAAGCAATCTTCTAGGGGGAATCCAAGTGGTTTATATCGAAGAGTTGCAGCCAGCACTCACACTTGATCAGTACTACTCTCTCCTCCACACCTTC

TACAACCAGCTGCTGAGAAGCAGGGTGCCGCCCCACCCCCACCCCCAGAGTCTGAGCGGCTTGCAGATGATCCTTAGCAG TGACAGGTATGCGCCAAGC

TTGCATGAACTCGGGCATTTTGATATCCCAGCCCTCTCAGATCCAGCAAGCCTGCAGTCCTTCATGAGAACCAAAGCCCAGCAGGCGAGAGAAAACATGA

CTAGAAGGGAGAA GTTAAAAGTTATGGAAAATGAATTGATACAGGCTTCAACAAAGCAGTTTTCTCTGGAGAAGTTGTATAAAGAGCCCAGCATTTCTA

GCAGACAGATGGTGGATTGCTGTAAGAGACTTCTTGAACAGTCGCTGCCATATCTGCATGGGATGCACCTCTGCGTCTCACATTTCTATTCTGTTATGCA

AGATGGAGACCTGTGCATCCCGTGGAACTGGAAGAAAGGAGAAGCCATGAAGTAACACAGATATCTGTTTTATTTTCTGAAGAAATGAAAAACTGTTGAA

TTTATTTAAATTCAGTTTGATATAACATTAGTATTTACATGTTAGAACAAAGTGTCTAACTGCTGCTATAAAAGTGGGGAGGGTTTTCTTTTTAGTGATT

TTATGCTAAGAAACTTGCTTTTAAAAGGTTTTATCCCCTAGACTTATGATGCTGATGGCTAGGCAAAAGATACTAGAAGAAAAAAAACTATTTTAAAGAT

ATGCAATAGAAGGTTCTGTAAGAGTCATATATTTTTATAGAATAAATGTGAGTAATGTAAGTTGGTCTCGCTCAGTATAGCTCTTTAGGACTGGGACTCC

ATTTTTACATGCAACACAGTTTAATGTGCACCTTCATAGTTACATCGTATACACACACACACTTTGTAGCCAGTAATAGACGGTTATTCAAGACAGATGA

CTGGCAAGTAGCAAAAGTTAAATAACCAAATTAAAAGTTAAATAACCAAATTAAAAATTAAATAACCAAATTTTGCTTAAGAGAAAGATTTTTTAAAACC

CTATTGAATATATACTATTAACATTGTCTGATACAAGTTTACTAAAGCATCAGTAACAGAGAACTTAAATACATGATTTCTTCTACCAATTAAAGTATCA

GTGGAGCATATACTTGGTGGGCACAGGCATCCTCAAGATGAGTAAGATGTAGGATTATAACTTAGCCTGAAGCTCCTTAAAAAGCTTTCTTCACTTCTTC

AGCTCTGGCCCAGGCAGAGCCCTGTGCTATGGCTCGCTCTCAGGTGAAGCATGGCCTCCTTTGTGCTCAGCTGTCTCCTGCACAGTGAGAGGCCTGCTCT

CTGTTCAGAGTAGACCCACAGTACATTAGAACAAAGGAGATGCTAAAATCAGTTTTTCATGTTTTGGGTTTTTATGAAACATCATTAATTTAAACAGTTC

AAATGTATGTTCAAAATAAGAAATGGCTTATAAAAGGATTGTGTGTGCCATTGTGGCTTTTGACCCATGCTAATGTGACAAATGTTGCTGTAAATACTCT

TATGAAACAGTCCCTAAGTAGATTTGGTGGCACACATCTTTAATCCCAGCTCTTGGGAAGCAGAGGCAGGTGGATCTCTGTGAGTTTAAGGCCAGCCTGG

TCTATAAAGTGAGTTTCAGGACAACCGGGGATGTTAAACACAGAGTAACCCTGTCTGGGGGGTGGGGCCGTCAAACCTGACATTTATTAGAAAATTGCTT

GGATTGTACCGTGTCTAATATCAGCTAACGTGGAATCTGCTGTAATGTGTGTTGTATTGGATTTGTCTCAGAACTAATTGTTACATAATAAAGCAAGCCT

TGGCCACC
Translation
 MFCHLRPLRR - UNI22422 - RFGLRKVLPHWLHYSRALSGAEAINALRPFYFAVHPDFFGQHPRER EVNENSLKRLSVYLENLQKPGFKSLKPT

QLTFYIREKTAQNSSEGQEPISTTG GFRAVRFTLHSSDLLSTVLYILNSCSLPVEHVQSLNTNVHSQPLKEATGMPDRPIKWHRSYYSFTGFKDPDEDL

THVSRVETTLT TSWLGSNGKGAVKKLRNSLPLRKELDRLKNELSELLQLSDIR RWQRGWGVAHRCSQLHSLSRLAQQNPGPLQNVKG GCTVVFTDRS

GMSALGHVMLGTMDVHHHWTR LFESLPSYFDLQRRMSALEAQISNLLGGIQVVYIEELQPALTLDQYYSLLHTFYNQLLRSRVPPHPHPQSLSGLQMIL

SS SDRYAPSLHELGHFDIPALSDPASLQSFMRTKAQQARENMTRREK KLKVMENELIQASTKQFSLEKLYKEPSISSRQMVDCCKRLLEQSLPYLHGM

HLCVSHFYSVMQDGDLCIPWNWKKGEAMK

For any suggestions or comments, please send an email to unitrap@crg.es