Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000046634 (Pkd1l1)
Chromosomal location
Chr 11: 8726728 - 8873268 (-)
Description
polycystic kidney disease 1 like 1 Gene [Source:MGI Symbol;Acc:MGI:2156538]
UniGene
Mm.146711 
MGI
MGI:2156538 
Uniprot/SWISSPROT
Q8R526 
Uniprot/SPTREMBL
Q5SVC7 
Human Ortholog
ENSG00000158683 (PKD1L1)
Omim not available
UniTrap UNI35398
Vector Insertion
Chr 11: 8836847 - 8841104
Public Clones IST12629C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32901
Vector Insertion
Chr 11: 8816249 - 8829479
Public Clones (sanger) IST14740H7 (tigm) IST10885F2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 38% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32478
Vector Insertion
Chr 11: 8757038 - 8761310
Public Clones IST14700E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32369
Vector Insertion
Chr 11: 8736205 - 8744670
Public Clones (sanger) IST10763F6 (tigm) IST10843H5 (tigm) IST11807D12 (tigm) IST14628E10 (tigm)
IST12927E1 (tigm) IST12978E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055297
Sequence
TTCTCCAACCCTCCTCCTGGCATTTCTCACACCTGCAACCTCTCTGCATCCTGGTATCATCCTGAGAGTTCCAGTCCTCTCACTCAGCATCCTCCCAGGG

CCACCTTGGTGACACAGCCTGAAAATGTTGAGCACTTTGCCATCTGCTGCTTCCCAGAAACAGATGCTCAGGCACTTCCAGCTCTGGGAATCCGTGTTCA

CGTGGCTTCCGGAACAGCTCTTTGTCTGCTGCTGGACTTTGGGGACAATTGTGGAGCTCAGATGAGACTGTGTACATTGGCAGGTGCAACTACTGTGACT

GGCTACCATCAGTACAGGAAAG AAGGAGTCTATGAGCTCAAGGCTGTTGTCCATGACTTTCATAGAGCCGAGGAACTGGGGCCCTATTATGTGGACATT

AGCCATGGGAATGTGTCTGTCTTCATGAATTCCAGCTCTATCCATGATAGCGAAGCTCTTTCCTTTGCTGACTCCCTCCCACAGCAGAGAG GCACAGTC

GTGGTGCATTGTTTTTCATCCATTTCTTCATACAATGTGTCCTTTATTTCTCAGACCCAAGTGGCCAGCGGCCAGGCCTGGTGTGGTGTGACTGTTGGGT

ATAAGATGCAAT CCGTGTCTGTCTATACCAATGGAACTGTGTTTGCTGCTAACACAAACATCACATTTGTGGCTATTACCGAGGAAACTATACCCCTGG

AGTTCGCTTGGTATTTCGGAGAGAACCCACCAGTGATGACAACTTCCAGAAGCATTAGAAGAAGGCTGAGCGTCCCTCAGTG GTACCGTGTGAAGGTCA

AGGCCACCAGCAGGATCGGCAGTGTGGTCTCTGAACCCCACCTCATCAGGGTGCAGAAGAGAATCATGGCCAATCGACTTGTGTCCACTGCCTCAGCCCT

GGTAAATGCCAATGTGTCCTTTGAGTGCAGGCTCAACTTTGGCACTGATGTAGCCTACCTTTGGAACTTTGGAGATGACACCATTGAGTTGGGCAGCAGC

TCCTCCAGCCATGTCTACAGCAG GGAGGGAGAGTTTACAGTTGAAGTCCTTGCCTTCAATAATGTCAGCTCCACTACCCTAAGAAAGCAGCTTTTCATC

GTGCGGGAGCCTTGCCAACCACCCCCAGTGAAGAACATGGGGCCTGCGAAGGTGCAG ATATGGAGGTCTCAGCCCCTGAGACTAGGAGTGACATTTGAA

GCTGCCATCCTCTGTAACATTTCCCAAGGGCTTTCCTACACCTGGAGCTTTGTGAGTGCTGAGATGACCACTGTTACCCTCCCTACTGCTGTCAACACCC

GCAGACAGACCATCATGCTCCCAAGCTACACACTGGAATGTGGGAACTACACCGCCATCGCCAAG GTTCAGATCAAGGGAAGCATGGTGTATAGCAACT

ACTGTGTTGGTGTAGAAGTTCGAGCTAGGGCGCCTGTCAGCGTCATCTCTGAAGGCACACACATCTTCATCTCCACGGCCACCTCAACCTTCATCATCCT

CAGAGGGGCCCAGTCCTATGACCCTGACAACCCAGGGGCTGCTCTCAG GTATCACTGGACTTGCACAGCGGCCAGCTCACCAAGGTGGCCCTGCTTTGA

TAACTCTACTTCATACCAAGTGGACACGCAAGCTCCTGCCATTTCCTTCCCAGCAAAATGGCTCAGTGAATGCTGTGACCAGTTCCTTGTGACACTGACG

GTCTCTAGCAGGGGACAGAACTCATCACAGGCCTTGATGTTCCTGTCTACCCGTCCTGACTTGGCCTTCAG ATTCGTCCACATCTCATGGGTCAACTTT

AGAGACATCTCTGTGAACTGGAATGAAGAAGTGTCTCTCCGGGCTGTGTGTGAAGACTGTGGAGATGTCCCAGACCTCACGTATTCCTGGGACCTCTTCC

TAGTCAATGCAACAGAGAAGAGTGCAGTGGAAG TCCCCTTCTGTAGTACTGTGGGGCTGCTAGGTGCCTTGGCACTTGGGACCAGTCTGAAGTCCTCTA

AGTCTGATCTGCCATCAAATCTGAGAGCACCACTGACACCACACTCACCGGAGCCTTCACCCACGCCTCTGGGCTGGACAGCTCTTTCCAACCTGGGAAG

CATTTCTGCTGAGTCCACAGCTGGTGGCCACCACGTTCCTGCTTCAGGAGCTGTGGCAGGCTCAGGGGAGCCTATGGAGGAGTATAGCTCACTGAGTTCC

CTGGCTGAGGAAGCCCTGATGACGAACAGCTCTGAGGGAAGCTGGCCCTCCCCCAGCTCTTCCACTGACTTTGATG - UNI35398 - ATTTTGAAGC

CTATTATAGCGACATCCAAGAAGCAGTGCTATCCCTAGGAAGACAACCAG - UNI35398 - GGACCAGTACAAACTTCCAGGAAGCAGGACCAAGCC

TGAGTGCTGAGGAGAGTGCCAGTTATGGGGACAACCTGCTGGGCCCTTTCCTCCACACAGGTAGAGCAAAGCCAACTCTCATGATCGACTGGCCCAAGGC

CCTGGTCAGCCAAGCTGCCTTCCATGGCTACACCACATCAG - UNI35398 - GTATCATGGGACCAGCTGTGACAATAAAACCATTCTCACTGAGCA

GTGGCAAGACATATGTCTTACAAGCTTCTGTAG CTTCAAAGCATGTCTTACTGGGCAAGGCTCAGCTCTACTTAACGGTCAACCAAGCTCCGCAGGACA

TGTCTTGTCAGGTGCGACCCCACCATGGTATGGAGGCATATACCATCTTCAGTGTCTTCTGCATGTCAGGGAAACCG - UNI32901 - GACTTTCAT

TATGAATTTCGTTACCGGATAGGAAACACTTCCTCACATACCCTGTACCGTGGTCAAGACACCCAGCATTATTTTTTATTGCCAGCTGGTGATTCTTCGG

ACAATTACAAAG - UNI32901 - TCATTGTTTCAACTGAGATCACAGATGGCCACGGCTCCAAGGTGCAGCCATGCACTGTGGCGGTGACTGTGCTA

CCCCGTTACCATGGAAATGACTGCTGTGACAAGGAACT - UNI32901 - ATATAACTCCACTCTGGAAAGCCTGTCTACTCTCCGGCTGGCAGGAAG

TTACATGGAAACCAGGAACTACATTACCATGATCACTGGGATCCTGAGCCGCTTGTATGTGGAGAGCAGAAACACTTCTTCGTGTGGTCAGTGGTCACAA

ATACAGGATGTATTAATTTCTTCAGCATGCAAAGTACCTTATACAGATCAG GAAGGAATGATGGATTCTATTCATATATTGAGAGACCTCATAAGCTTC

CCTAATAAG TTGAGCTTGACGAGTGCCATGTGCATCTTCAAATACACCAAGATGTTCCTTGCTCAAGGCCAGTTCTCCAGGAGGTTGCTAGTCGACAAA

AAACTAAGAGTTGAATTTGTCCTTCTCATCTCTGGAGTCTGGGAAGCTGCCAAAGAGGATGCGAGGGATGGGGACTATCTGCAGGAAGAAGGCATGAAGA

TCATCTCTGACATGTTACTA ATTCACGTAAGCACTGGGCAGATGGAGTTCCAGACCCTTCTCCATCGTAGCCCTCAGAGCTCTATCCAGAACCTAGGCT

TCGTCCAGGTACATTTCCCCAGTGACCTGGCCTCCTTGCACAGTACTACTCAAGAGGCAACACAAAGCTCATGCTATATCAGCCAGCTCATGTTCTTCAT

GAAGAGTCCTTATCTAGGGGGACAAGTTCCTGGGCAG GTGGGTGGTGTCATGATCCCTAGGCTCTATAGCTGCGAGAGTAGAAGACCTATCCTCAGAGG

ACAACTGGAGACACCTGTGACTATGGAGTTTGGGGAAGAAGACTACCTG CACAAGAGAAATCCAGCCATGTTTGTGTTGCTTCGGGATGAGGTGAATGT

CCACCGGTTTACTGGGCTTTCAGAAAACTCCCAGGAATCTTTACAGATACACATCAAATTCTCTAAGCCCGTTACAAGACCCTTTCCCATCATACTGTTA

GTAAG GTTCTCTGAGAAAGCCACGCCTTCTGATTTTCTTGTGAAGCGGGTCTACTTCTGGGATGAGCAGACTGTACAAATGTATGTACCTGCTGCTCCA

TGGAAAG GAGCCAATGTGGGATATTTATCGCTATTAGATGCTGACTATGACAGGAAACCTCCAAACAAATATCTTGCTGGGGCTGTAAACTATACAGTG

CATTTCCAGTGGATCCAATGTGTGTTCTGGGACAAGACAGAGTGGCGATCTGAAGGTCCCTATCCACAGCCAGGATCGTCTCCTGAAAAAGTCAACTGCA

G CTACCATCACCTTGCACCTGTCTCTGTCCTAAGAAGAAAGCTGAATGCCACTCTTGAAGTGAGCAGCATTTCTGAGTTTCAGAG TCACCCACACAAC

TTGCTCCCCGGTATTTTCAGTGCATTTCTCTTGGTTCTTTATGGAATTTTGGTGAGTAAAAGCAGATATGTAGACTGTCATGAGAAAAAGAATCCAGGTT

TTATTTTTCTGGAAGAAGATACACTGCCTGGCTACCAGCTGTATGCAGTCGTCATCGACACTGGCTTCCGGTCACCAGTCAGATTTACCTCAAAG GTTT

TCATTGTTCTATGTGGTGAAAATGGATGCTCAGAAACGAAAGAACTCTGTTGTCCAGAGAAGCCCTTATTTGGAAGGAATTCCAGGCACACCTTCATTCT

GAG CATACCTAACCAACTGGGTCCACTCCAGAAGATCCGCCTCTGGCACGACAGTAGTGGATCTTCCCCATGCTGGTTCATCAGCCACGTGATGGTGAA

GGAGCTATGCTCAGGACAAGCCTGGTTCTTCTCTGCTCAGTGCTGGCTGGCTGTGAGCAAATTGGGTGGCCATGTATTACGAGAATTCTTCTGCCTGAGC

CATGGTCTCGGTTTCTGGAAG CTTTTCTATTCAAAGTTCACTGAGTACCTGGAGGATTTCCACATCTGGCTCTCACTGTACAGTCAGCCCCCATCCAGA

AGCTACCTACACACACAGCGGCTTGCCGTGTCCTTCTGCCTGCTGTGTGTCTACTCGTGCCTCACTGCCCTGGTCACTGTGCGAGACCATCAACAG CGC

CCCCTGGATGTGGGGCCCACAGCTATCACTCTGGAACCCTTCTGTATGGCTCTACTGTGCACCCTCCTGGCCTGTCCAGTTGCACAGCTTCTGTCACTGC

TCTTCAGGTGCAGCAAG GAAGCCAGAGGGGATATGCAGGCTTCAACACAGTGGCCTCTAAGAGGAGTGAAGACAGAGACACCTCAGG GCCATGATTCC

AGTGGGAGACCAGATTCAAGGCAGCCCTCACCA CATCCCACATCAGACCTTCTCCCCTGGAATGACCAAGCTTGGAGGATAGCAGCCAGCAGCAGTGCT

GTGGTCTGTTCACCGTTCCCAATGGAGGCCTGCAGCCATAAGCATCATGATCTGAGAGAGAAGAGCCATTACTCTCCTCCCAGTTCACAAG CTCCTGGC

AGTGGTTTTGAAGAACTTGGGTCCCAGAAGTCAAGGGTCTGTCTGCTCTGGTCAAGCTCTGTGGCCTGGGCTATCTCTGGATCAGCTTCCCTGGCCTGTG

GTTTGGGGACAGGATTCCTAGGCTACTG GTTTGTGCCAGCACAGTGTATGTGGTGGCTATACCTGCTGCTTCTCTCTCTGGTCTGCTGCGCATTCATCA

CCCAGCCACTCATG ATCTGCTTGGCAGCACTTGTCTTTGCTTGGAAACGGAAACATGACAGCAAGTTTTTTACTGAGTCTTTACAAGATGCGACCAAGG

GTCTGGATTTGGAATTGGAAGAACATTCCAGAACCCGTGTTCCTCTTTCTCCTATCTCCTATAGTCCTGACACTGCTGAGGAGGCTGAAAGG GTCTTGG

CTACCCGACAACGAGAACGCCACCTGCGCTGGGCTCAGACACCATCCAAGGCTAAGCTCAGAGTGACCGGGGAGAGACTGAGGAGAGAGAGCATCATGCA

GGCAGCCCTGAG - UNI32478 - AGACATGACCACACACAGCATCATGCTACTGCTGCTTTTGTTTATAGCATATGGGAGATTCTGCCCAGGTGAAA

TTTCTCTCAATCATGCCATCAGGAAAGCATTTACAAG - UNI32478 - AAAGGCCAATCACTCCTTGGGGGACCTCAGCAGCACAGAAGACTGGTGG

GACTGGACGCTGAGCACACTGCTAGATGAGCTGTACCCAGAAAGAACATCTGCTAGAGCCTGGGGGGCTCAG - UNI32478 - CCTGGAGCTCTTGG

AGGGCAATGCCACCTAATAGGCCCCCCGGTGGTCAAACTGCTGAAGATTTCTGCTGGCACTGCATGCACG CCTCCCAGACCATTCTCAGAGCTTGTGGA

AGATGTACTTCCTATGCACAGCAATGACCTTGACCTTGAGAACCAAAATGTGTCCCCTGGCGGCCCTGAGACCTGTGGCGTGAAGAAAGAGAGCTACATG

CATAGCCTAGGAAAAACAAG ACATGAAGCCCATGCAGCTCTGACTGCCCTCAGGGCTAGCAAGTGGATCGACCACAGCACAAGGGCCATGTCTGTGCAC

TTCACTCTCTACAACCCTCCAACACAACTCTTCACAAGCGTGATCCTGGGCACAGAATGTCTCCCCTCAGGAGGTCTTGTCCCCTCATTCCTGGTAGAGT

CCTTCCGCATCTTCTACAGTGACTCAGCCCTAAAGTACCTTCTTATGCTTTCTGAG CTGCTGTTCCTGGTACTCAACGTGATCCACCTCTGTTTCCAGC

TCTGGGGGATGACAACCAAGGGCATCCTCAGCTACTGGAGAAAACCAAGACACTGGCTGGAG CTCTCTATGGTTGGAGTAGCAATAGCCTACTATGCAG

CCTCTGGTCACCTCACTACTCTTGCTGTGAACATCACCGACCAGTTCCACAAAGGACTTTATCAGAGGCTTGTGGACATCGGCCTGATGGTGTCATGGCA

TCAG - UNI32369 - AGGGCGCGATGCCTCCAAGGAATCCTCTTGTTCCTCTGGATGTTGAAATATGTTCATCTTCTCAGCTCTCTAAGCACCATGA

CACCCTTCTCAGCAGTGACCTGTTTTCCTCTCTTCAGAGTCTTG - UNI32369 - CTGGTGGGGGCCCTATTGCTGGCTGCCCATTACCACTCGCGC

TGGTTTCTGCTCTTCACCGGGACACTGTCACATGGCACCTCGGCAGAAGCATTTCCTGGGCTACTGCTTCAATTTCCTGGAAGAAGTAAAAAAGACTCAT

GGCATAACTGTTTGAAGTCTGACCACGGAGTTATGCGTTGTTACTATGGGACCCTCTTTCTGTTGCTGGCTACTCTGGGTTTCAGAATG - UNI32369

 - TTGAGAGCTACCTTCCTGACTGTTTTCCAAAACAGAAAGTCTTCTCACAGAAAACCTCTCGTGACACTTAAAGACATTGCTGTTTACACATGGCATA

AAGTCCTCACCCTTCTGGGGCTGGAAACAACTTTGGAAGAGACTGAAGTGGCTACAGACCAT ATTTATTACCTGGATGAATTTTCAAGTCTCTTGGATG

AACTTCTGATGAAGATCGATGGTTTGTCTGACAGCCTAGAACTTTCTATCCTAGAAAACCAATGGAAGAGAGCACTAGAGTCAAGGGCAGGTGACAGTCC

TCCAGTTGGCAGTTCAGAGTACCAAGCTACTGGG GTATCTGGTCCCTTAGCTGCTGAGTCAGAGTGAAGAGGGAGGAAACCGGATGCCTGGAATAGGAA

AGAGCTGGACATCACATC
Translation
FSNPPPGISHTCNLSASWYHPESSSPLTQHPPRATLVTQPENVEHFAICCFPETDAQALPALGIRVHVASGTALCLLLDFGDNCGAQMRLCTLAGATTVT

GYHQYRKE EGVYELKAVVHDFHRAEELGPYYVDISHGNVSVFMNSSSIHDSEALSFADSLPQQRG GTVVVHCFSSISSYNVSFISQTQVASGQAWCGV

TVGYKMQS SVSVYTNGTVFAANTNITFVAITEETIPLEFAWYFGENPPVMTTSRSIRRRLSVPQW WYRVKVKATSRIGSVVSEPHLIRVQKRIMANRL

VSTASALVNANVSFECRLNFGTDVAYLWNFGDDTIELGSSSSSHVYSR REGEFTVEVLAFNNVSSTTLRKQLFIVREPCQPPPVKNMGPAKVQ IWRSQ

PLRLGVTFEAAILCNISQGLSYTWSFVSAEMTTVTLPTAVNTRRQTIMLPSYTLECGNYTAIAK VQIKGSMVYSNYCVGVEVRARAPVSVISEGTHIFI

STATSTFIILRGAQSYDPDNPGAALR RYHWTCTAASSPRWPCFDNSTSYQVDTQAPAISFPAKWLSECCDQFLVTLTVSSRGQNSSQALMFLSTRPDLA

FR RFVHISWVNFRDISVNWNEEVSLRAVCEDCGDVPDLTYSWDLFLVNATEKSAVEV VPFCSTVGLLGALALGTSLKSSKSDLPSNLRAPLTPHSPEP

SPTPLGWTALSNLGSISAESTAGGHHVPASGAVAGSGEPMEEYSSLSSLAEEALMTNSSEGSWPSPSSSTDFDD - UNI35398 - DFEAYYSDIQEA

VLSLGRQPG - UNI35398 - GTSTNFQEAGPSLSAEESASYGDNLLGPFLHTGRAKPTLMIDWPKALVSQAAFHGYTTSG - UNI35398 - GIM

GPAVTIKPFSLSSGKTYVLQASVA ASKHVLLGKAQLYLTVNQAPQDMSCQVRPHHGMEAYTIFSVFCMSGKP - UNI32901 - DFHYEFRYRIGNT

SSHTLYRGQDTQHYFLLPAGDSSDNYKV - UNI32901 - VIVSTEITDGHGSKVQPCTVAVTVLPRYHGNDCCDKEL - UNI32901 - LYNSTL

ESLSTLRLAGSYMETRNYITMITGILSRLYVESRNTSSCGQWSQIQDVLISSACKVPYTDQ EGMMDSIHILRDLISFPNK LSLTSAMCIFKYTKMFLA

QGQFSRRLLVDKKLRVEFVLLISGVWEAAKEDARDGDYLQEEGMKIISDMLL IHVSTGQMEFQTLLHRSPQSSIQNLGFVQVHFPSDLASLHSTTQEAT

QSSCYISQLMFFMKSPYLGGQVPGQ VGGVMIPRLYSCESRRPILRGQLETPVTMEFGEEDYL HKRNPAMFVLLRDEVNVHRFTGLSENSQESLQIHIK

FSKPVTRPFPIILLVR RFSEKATPSDFLVKRVYFWDEQTVQMYVPAAPWKG GANVGYLSLLDADYDRKPPNKYLAGAVNYTVHFQWIQCVFWDKTEWR

SEGPYPQPGSSPEKVNCS SYHHLAPVSVLRRKLNATLEVSSISEFQS SHPHNLLPGIFSAFLLVLYGILVSKSRYVDCHEKKNPGFIFLEEDTLPGYQ

LYAVVIDTGFRSPVRFTSK VFIVLCGENGCSETKELCCPEKPLFGRNSRHTFILS SIPNQLGPLQKIRLWHDSSGSSPCWFISHVMVKELCSGQAWFF

SAQCWLAVSKLGGHVLREFFCLSHGLGFWK LFYSKFTEYLEDFHIWLSLYSQPPSRSYLHTQRLAVSFCLLCVYSCLTALVTVRDHQQ RPLDVGPTAI

TLEPFCMALLCTLLACPVAQLLSLLFRCSK EARGDMQASTQWPLRGVKTETPQG GHDSSGRPDSRQPSP HPTSDLLPWNDQAWRIAASSSAVVCSPF

PMEACSHKHHDLREKSHYSPPSSQA APGSGFEELGSQKSRVCLLWSSSVAWAISGSASLACGLGTGFLGYW WFVPAQCMWWLYLLLLSLVCCAFITQP

LM ICLAALVFAWKRKHDSKFFTESLQDATKGLDLELEEHSRTRVPLSPISYSPDTAEEAER VLATRQRERHLRWAQTPSKAKLRVTGERLRRESIMQA

ALR - UNI32478 - RDMTTHSIMLLLLLFIAYGRFCPGEISLNHAIRKAFTR - UNI32478 - RKANHSLGDLSSTEDWWDWTLSTLLDELYPE

RTSARAWGAQ - UNI32478 - PGALGGQCHLIGPPVVKLLKISAGTACT PPRPFSELVEDVLPMHSNDLDLENQNVSPGGPETCGVKKESYMHSLG

KTR RHEAHAALTALRASKWIDHSTRAMSVHFTLYNPPTQLFTSVILGTECLPSGGLVPSFLVESFRIFYSDSALKYLLMLSE LLFLVLNVIHLCFQLW

GMTTKGILSYWRKPRHWLE LSMVGVAIAYYAASGHLTTLAVNITDQFHKGLYQRLVDIGLMVSWHQ - UNI32369 - RARCLQGILLFLWMLKYVH

LLSSLSTMTPFSAVTCFPLFRVL - UNI32369 - LVGALLLAAHYHSRWFLLFTGTLSHGTSAEAFPGLLLQFPGRSKKDSWHNCLKSDHGVMRCYY

GTLFLLLATLGFRM - UNI32369 - LRATFLTVFQNRKSSHRKPLVTLKDIAVYTWHKVLTLLGLETTLEETEVATDH IYYLDEFSSLLDELLMKI

DGLSDSLELSILENQWKRALESRAGDSPPVGSSEYQATG VSGPLAAESE

For any suggestions or comments, please send an email to unitrap@crg.es