Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000046792 (Zfp787)
Chromosomal location
Chr 7: 6083091 - 6107573 (-)
Description
zinc finger protein 787 Gene [Source:MGI Symbol;Acc:MGI:1914359]
RefSeq_dna
NM_001013012 
RefSeq_peptide
NP_001013030.1 
UniGene
Mm.3254 
MGI
MGI:1914359 
Uniprot/SWISSPROT
Q8BIF9 
Human Ortholog
ENSG00000142409 (ZNF787)
Omim not available
UniTrap UNI16792
Vector Insertion
Chr 7: 6094753 - 6107446
Public Clones (sanger) P115G06 (ggtc) D088G04 (ggtc) CMHD-GT_298C11-3 (cmhd) IST14336E9 (tigm)
IST14662G7 (tigm) IST12643B6 (tigm) IST14372H6 (tigm) IST14634E10 (tigm)
IST14389C5 (tigm) IST10914E9 (tigm) IST14490A8 (tigm)
Private Clones OST453999 (lexicon) OST439505 (lexicon) OST295561 (lexicon) OST283208 (lexicon)
OST202730 (lexicon) OST65064 (lexicon) OST30149 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000049805
Sequence
GACCCCAGGGTCTGAGTCGCCGCTGCCGCCGCTGCCACCATCCGCGAGGCAGGCGAGAGGAAGAGTGCGGCGTGACGGCCCCGGGGCCGCGGAG - UNI

16792 - GGACCCAGATATGGAGCTTCGAGAAGAAGCTTGGTCTCCGGGGCCACTGGATTCTGAGGACCAGCAGATGGCCAGTCATGAGAACCCAG TG

GACATCCTCATCATGGATGACGATGACGTCCCCAGCTGGCCCCCGACCAAGCTGTCCCCACCCCAGTCTGCACCTCCTCCTGGGCCCCCGCCCAGGCCGC

GGCCACCAGCACCCTACATCTGCACTGAGTGTGGCAAAAGCTTCAGCCACTGGTCGAAGCTGACACGACACCAGCGCACGCACACAGGCGAGCGGCCCAA

TGCCTGTACCGACTGCGGCAAGACCTTCTCGCAGAGCTCGCATTTGGTGCAGCACCGGCGCATCCACACAGGCGAGAAGCCATATGCCTGCTCAGAGTGC

GGCAAGCGCTTTAGCTGGAGCTCCAACCTCATGCAGCACCAGCGCATCCACACGGGCGAGAAGCCTTATACTTGCCCCGACTGCGGCCGCAGCTTCACAC

AGAGCAAGAGCCTAGCCAAGCACCGGCGCTCCCACAGTGGTTTAAAGCCCTTCGTGTGTCCGCGCTGCGGCCGTGGCTTCAGCCAGCCCAAGAGCCTGGC

ACGCCACCTGCGGTTGCACCCAGAGCTGTCAGGGCCAGGTGTGGCAGCCAAGGTGCTGGCAGCCAGCGTGCGGCGCGCCAAGGCACCGGAGGAGGCCACA

GCAGCGGACGGCGAAATCGCTATCCCAGTGGGCGATGGCGAGGGCATTATTGTGGTGGGCCCGCCAGGGGATGGTGCTGCA GGCCGCAGCTCTGGCTGG

GGTGGGGACGCGGGCAACGGGGACACGGTCGCGCAGGGCGCCGGCGCCCAAGCCGTATGTGTGCATGGAGTGCGGGAAGGGTTTTGGGCACGGGGCTGGG

CTGTTGGCCCACCAGCGCGCTCAGCACGGGGATGGGCTCGGGGTAGCGGTTGGTGA
Translation
 - UNI16792 - MELREEAWSPGPLDSEDQQMASHENPV VDILIMDDDDVPSWPPTKLSPPQSAPPPGPPPRPRPPAPYICTECGKSFSHWSKLTRH

QRTHTGERPNACTDCGKTFSQSSHLVQHRRIHTGEKPYACSECGKRFSWSSNLMQHQRIHTGEKPYTCPDCGRSFTQSKSLAKHRRSHSGLKPFVCPRCG

RGFSQPKSLARHLRLHPELSGPGVAAKVLAASVRRAKAPEEATAADGEIAIPVGDGEGIIVVGPPGDGAA GRSSGWGGDAGNGDTVAQGAGAQAVCVHG

VREGFWARGWAVGPPARSARGWARGSGW
Transcript ENSMUST00000094870
Sequence
AAGGTCACTTCCGGCCTGGGCGCCCGTCCCCCTGACCCCAGGGTCTGAGTCGCCGCTGCCGCCGCTGCCACCATCCGCGAGGCAGGCGAGAGGAAGAGTG

CGGCGTGACGGCCCCGGGGCCGCGGAG - UNI16792 - GGACCCAGATATGGAGCTTCGAGAAGAAGCTTGGTCTCCGGGGCCACTGGATTCTGAGG

ACCAGCAGATGGCCAGTCATGAGAACCCAG TGGACATCCTCATCATGGATGACGATGACGTCCCCAGCTGGCCCCCGACCAAGCTGTCCCCACCCCAGT

CTGCACCTCCTCCTGGGCCCCCGCCCAGGCCGCGGCCACCAGCACCCTACATCTGCACTGAGTGTGGCAAAAGCTTCAGCCACTGGTCGAAGCTGACACG

ACACCAGCGCACGCACACAGGCGAGCGGCCCAATGCCTGTACCGACTGCGGCAAGACCTTCTCGCAGAGCTCGCATTTGGTGCAGCACCGGCGCATCCAC

ACAGGCGAGAAGCCATATGCCTGCTCAGAGTGCGGCAAGCGCTTTAGCTGGAGCTCCAACCTCATGCAGCACCAGCGCATCCACACGGGCGAGAAGCCTT

ATACTTGCCCCGACTGCGGCCGCAGCTTCACACAGAGCAAGAGCCTAGCCAAGCACCGGCGCTCCCACAGTGGTTTAAAGCCCTTCGTGTGTCCGCGCTG

CGGCCGTGGCTTCAGCCAGCCCAAGAGCCTGGCACGCCACCTGCGGTTGCACCCAGAGCTGTCAGGGCCAGGTGTGGCAGCCAAGGTGCTGGCAGCCAGC

GTGCGGCGCGCCAAGGCACCGGAGGAGGCCACAGCAGCGGACGGCGAAATCGCTATCCCAGTGGGCGATGGCGAGGGCATTATTGTGGTGGGCCCGCCAG

GGGATGGTGCTGCAGCGGCCGCAGCTCTGGCTGGGGTGGGGACGCGGGCAACGGGGACACGGTCGCGCAGGGCGCCGGCGCCCAAGCCGTATGTGTGCAT

GGAGTGCGGGAAGGGTTTTGGGCACGGGGCTGGGCTGTTGGCCCACCAGCGCGCTCAGCACGGGGATGGGCTCGGGGTAGCGGTTGGTGAGGAGCCTGCA

CACATCTGCGTGGAGTGTGGTGAGGGCTTTGTGCAGGGTGCCGCACTGCGGAGACACAAGAAGATCCATGCAGTTGGGGCGCCTTCGGTCTGCAGCAGCT

GCGGACAGAGTTTCTATCGGGCGGGTGGAGAGGACGATGGAGAGGACCAGTCGGCTGGTGCGCGGTGTGCCGAATGTCGGGGTGGGGAGGCCCGGTAGGG

ACGGGGAGGCCCGGGGGGTGGACAGGGCCCCTCGGGCTCGGTGGGAACTACCAGTGTGCAAGACCACGAGGGAGGCCCAGAGAGAATCAGACCGAAAGGA

ACAGCGGCCTTGTCTCCTTCCTTACTCCGTGCTGTTCTGGGTGTGAGGGGACCTGCAACTATTGGGTTCTCAGGACTGTCCACAGCCTCTCTGCCGACCC

GCCCTACCGCCTGGTGGGCTGGCCCTTTGTAGGTTTCCATTCTGGGAGCCAGAGACTGAGAGAACTGCAAGGATCAATTGGCACTAGACCCTCAAGGGAA

AGACCACCCCCACTACAGGTGTTGGGCTGCGGTGTCGTAAGAAATGGAGGGAATCCTGGCCTTATGCATCAAAAGGGCTTCCTTCCCTTCTAGAATTTTC

TTTTAATCATACTGTCTGACCCGTCCCATCCATTATTTTTTCTGCCCCCCATGGGTCCTTATCAATTTTCTAGCCCAAGTCGTTCCTCTTCCTCTTGGAT

TTGCAGTAGCAGAGGCGTGAAGTAGCCTCCTGTTCCCAGCACGGTCTTATTGAGAGGTCCTGGCAGTGGAAAAAGGGATGTGGGGGCAATAAATGGCATT

ATTCAATTGTCCCA
Translation
 - UNI16792 - MELREEAWSPGPLDSEDQQMASHENPV VDILIMDDDDVPSWPPTKLSPPQSAPPPGPPPRPRPPAPYICTECGKSFSHWSKLTRH

QRTHTGERPNACTDCGKTFSQSSHLVQHRRIHTGEKPYACSECGKRFSWSSNLMQHQRIHTGEKPYTCPDCGRSFTQSKSLAKHRRSHSGLKPFVCPRCG

RGFSQPKSLARHLRLHPELSGPGVAAKVLAASVRRAKAPEEATAADGEIAIPVGDGEGIIVVGPPGDGAAAAAALAGVGTRATGTRSRRAPAPKPYVCME

CGKGFGHGAGLLAHQRAQHGDGLGVAVGEEPAHICVECGEGFVQGAALRRHKKIHAVGAPSVCSSCGQSFYRAGGEDDGEDQSAGARCAECRGGEAR

For any suggestions or comments, please send an email to unitrap@crg.es